SecReT6
Protein ID: 116619374
SecReT6 ID153
T6SS typei4b
Gene symbol-
Locus tagAcid_0232
StrainCandidatus Solibacter usitatus Ellin6076
Repliconchromosome [GenBank: NC_008536] [Browse all T6SS(s) in this replicon]
Location [Strand]313484..314971 [+]
Producthypothetical protein
NoteTssC
UniProt IDQ02CH1
KEGG IDsus:Acid_0232
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 8.30E-192, Aligned region: 68..491
Protein Sequence: 495 a.a.     [Download]
>gi|116619374|ref|YP_821530.1| unnamed protein product [Candidatus Solibacter usitatus Ellin6076]
MSKVEKDATAAKPAEQTLEVSLLDQIVDEGRLARDPAARERGKDLVKEFVAQVLEGAMTVSKDAEIMITA
RIAQIDHLVSLQLNEVLHAPEFQKLEGSWRGLKYLMDQSETSDKLKIKVLNVTKKELLRDLQRAPEFDQS
AMFKKVYEEEYGVFGGAPFSALIGNYEFGRGPEDIELLEKVAQVASAAHAPFLTAAAPEMMNLDSYTSID
APRDMAKVFDSSEYAKWKSFRASEDSRYVGLCLPHVLMRLPYGKDGVQVDAFNYEEGVDGNDHSKYLWGN
AAFALGARLTQAFAQYGWCAAIRGVEGGGLVEGLPTHNFTTDSGDVALKCPTEAPITDRREKELADLGFV
PLVHCKGTDYAAFFSVQSGQKAKVYDSEAANANARLSTQLPYILAVSRFAHYLKAMMRDKVGSFMSRADA
EVFLNQWIIQYVCPDDQASQHYKAAHPLREARVEVSEVPGKPGVYRAVAFMRPHFQLDELSVSLRLVAEL
PKGRG
 
Nucleotide Sequence: 1488 bp     [Download]
>gi|116619145|ref|NC_008536.1|:313484-314971 Candidatus Solibacter usitatus Ellin6076 chromosome, complete genome
ATGAGTAAAGTCGAAAAAGATGCAACGGCGGCAAAACCGGCGGAGCAAACGTTAGAGGTTAGCCTGCTCG
ACCAAATTGTCGATGAAGGCAGGCTGGCACGCGACCCTGCGGCGCGGGAGCGCGGCAAGGACCTGGTGAA
GGAGTTCGTCGCCCAGGTGCTGGAAGGCGCGATGACGGTGTCCAAGGACGCCGAAATCATGATCACCGCG
CGCATCGCGCAGATCGATCACCTGGTCTCCCTGCAATTGAACGAAGTCCTGCATGCCCCGGAATTCCAGA
AGCTTGAGGGCTCGTGGCGCGGGCTGAAATACCTGATGGATCAGAGCGAAACCAGCGACAAGCTGAAAAT
CAAGGTTCTGAACGTCACCAAGAAAGAACTACTCCGCGACCTGCAGCGCGCTCCCGAGTTCGATCAGAGC
GCCATGTTCAAGAAAGTCTACGAAGAGGAATACGGCGTCTTCGGCGGCGCGCCTTTCTCGGCTTTGATCG
GCAATTACGAATTCGGGCGCGGACCCGAGGATATCGAATTGCTTGAAAAGGTCGCCCAGGTGGCTTCCGC
GGCGCACGCTCCGTTCCTGACGGCGGCGGCTCCGGAGATGATGAACCTGGACAGTTACACCTCCATCGAC
GCCCCGCGCGACATGGCGAAGGTCTTCGACTCCAGCGAATACGCCAAGTGGAAGAGCTTCCGGGCCAGTG
AAGACTCGCGCTACGTCGGTCTTTGCCTGCCCCACGTGCTGATGCGCCTGCCGTACGGCAAGGACGGCGT
GCAGGTCGATGCCTTTAACTACGAAGAGGGTGTCGATGGCAACGACCACAGCAAGTATTTATGGGGTAAC
GCCGCGTTTGCCCTGGGAGCGAGACTCACCCAGGCATTCGCCCAGTATGGCTGGTGCGCGGCCATCCGCG
GCGTGGAAGGCGGCGGCCTGGTAGAGGGACTGCCCACCCACAACTTCACCACCGATTCGGGCGACGTTGC
CTTGAAATGCCCCACCGAAGCGCCCATCACCGACCGGCGGGAAAAGGAACTCGCCGATCTCGGATTCGTT
CCGCTGGTCCACTGCAAGGGCACCGACTATGCGGCGTTCTTTAGCGTCCAGTCAGGTCAGAAGGCCAAGG
TCTACGACAGCGAGGCGGCCAACGCGAATGCGCGTCTCTCCACTCAGCTGCCGTACATTCTGGCGGTTTC
GCGCTTCGCCCATTACCTGAAGGCCATGATGCGCGACAAGGTAGGCAGCTTCATGTCGCGTGCCGATGCC
GAGGTTTTCCTCAATCAGTGGATCATCCAATATGTCTGCCCGGATGATCAGGCCTCGCAGCACTATAAAG
CCGCCCACCCGCTGCGCGAGGCGCGGGTCGAGGTGTCCGAAGTCCCTGGCAAGCCCGGAGTCTATCGGGC
GGTTGCTTTCATGCGGCCGCACTTCCAACTCGACGAGTTGTCGGTTTCTTTGCGTCTGGTGGCGGAATTG
CCCAAGGGCCGGGGCTAA
 Primer design