SecReT6
Protein ID: 116619375
SecReT6 ID153
T6SS typei4b
Gene symbol-
Locus tagAcid_0233
StrainCandidatus Solibacter usitatus Ellin6076
Repliconchromosome [GenBank: NC_008536] [Browse all T6SS(s) in this replicon]
Location [Strand]315027..315515 [+]
Producthypothetical protein
NoteTssD
UniProt IDQ02CH0
KEGG IDsus:Acid_0233
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.80E-40, Aligned region: 7..137
Protein Sequence: 162 a.a.     [Download]
>gi|116619375|ref|YP_821531.1| unnamed protein product [Candidatus Solibacter usitatus Ellin6076]
MAQVDYFLKIDGIDGESLQKGHEKEIEIMSFSWGESNAGSFAGNLGGGSGKVSMQDFHFTVPVNKSSPKL
FLACATGEHIKSAVLVCRKAGKTQQEFLKWKFTDLLISSYNTGGSGGSDVVPIDQVSFNFTKIEVSYAPQ
KQDGSLDAALPAGYDLKAGQKV
 
Nucleotide Sequence: 489 bp     [Download]
>gi|116619145|ref|NC_008536.1|:315027-315515 Candidatus Solibacter usitatus Ellin6076 chromosome, complete genome
ATGGCACAGGTAGACTATTTCTTGAAGATTGATGGCATAGACGGTGAGAGCCTGCAAAAAGGCCATGAAA
AGGAGATCGAAATCATGTCCTTTTCGTGGGGCGAATCGAACGCAGGTTCTTTTGCCGGAAACCTCGGGGG
CGGCTCGGGCAAGGTGAGTATGCAGGATTTCCACTTCACCGTGCCGGTGAACAAGTCCTCGCCGAAGCTG
TTTCTCGCCTGCGCCACCGGCGAGCACATCAAGAGCGCGGTCCTGGTTTGCCGCAAGGCGGGCAAGACAC
AGCAGGAGTTCCTGAAGTGGAAGTTCACGGACCTGCTGATCTCGTCGTACAATACCGGCGGCTCGGGCGG
TTCGGATGTGGTGCCGATCGATCAGGTCTCGTTCAACTTCACGAAGATCGAAGTATCGTACGCACCGCAG
AAGCAGGACGGTTCTCTGGACGCGGCGCTCCCGGCAGGCTACGACTTGAAGGCCGGCCAGAAGGTCTAA
 Primer design