SecReT6
Protein ID: 116619376
SecReT6 ID153
T6SS typei4b
Gene symbol-
Locus tagAcid_0234
StrainCandidatus Solibacter usitatus Ellin6076
Repliconchromosome [GenBank: NC_008536] [Browse all T6SS(s) in this replicon]
Location [Strand]315543..316280 [+]
Productvirulence protein, SciE type
NoteTagJ
UniProt IDQ02CG9
KEGG IDsus:Acid_0234
PDB IDNA
Domain hit(s) vs Pfam ImpE [PF07024], Evalue: 2.00E-39, Aligned region: 104..231
TPR_19 [PF14559], Evalue: 0.0002, Aligned region: 6..65
Protein Sequence: 245 a.a.     [Download]
>gi|116619376|ref|YP_821532.1| unnamed protein product [Candidatus Solibacter usitatus Ellin6076]
MTAGPLFHAGKLDQAIQALGAELRDNPEDVQRRTFLFELLCFAGAYDRAEKHLDVLAQGNKDTQLGALLY
AGALHAERTRTELFQKREYPRPAGDAAPLAGTLNGQPFESFADADPRIGARLEVYAAGQYMWLPLEHIAS
IEMEAPKRLRDLLWSPALVRTGPGFKDRELGEILLPVLTPLSFRNADDAVRLGRMTLWENTEDGEPAPAG
QKMFLVDDEEFPILELRKLEFHPRQTDSDEHAPTQ
 
Nucleotide Sequence: 738 bp     [Download]
>gi|116619145|ref|NC_008536.1|:315543-316280 Candidatus Solibacter usitatus Ellin6076 chromosome, complete genome
ATGACTGCCGGACCATTGTTTCACGCCGGCAAGCTCGATCAGGCGATACAGGCGCTGGGCGCCGAACTCC
GGGACAATCCGGAGGACGTCCAGCGCCGTACGTTTCTATTCGAGTTGCTGTGCTTTGCAGGGGCCTACGA
CCGGGCCGAGAAGCACCTGGATGTCCTTGCGCAGGGCAACAAGGACACTCAATTGGGAGCCTTGTTGTAC
GCCGGCGCATTGCATGCCGAACGAACGCGAACCGAGCTATTTCAGAAGCGGGAGTACCCACGGCCGGCTG
GCGACGCTGCCCCGTTGGCCGGGACGCTGAACGGACAGCCGTTCGAAAGTTTTGCGGATGCCGACCCGAG
AATCGGCGCCCGGCTGGAAGTGTACGCCGCCGGGCAGTACATGTGGCTGCCGCTGGAACACATCGCCTCC
ATCGAAATGGAGGCGCCGAAGCGCTTGCGGGATCTGCTATGGTCGCCCGCCCTGGTGCGCACCGGCCCGG
GCTTCAAAGACCGCGAACTCGGTGAGATACTGCTGCCGGTGCTGACGCCGCTGTCCTTCCGGAACGCGGA
CGACGCCGTTCGTTTGGGCAGGATGACCTTGTGGGAGAATACCGAAGACGGCGAACCGGCGCCGGCCGGA
CAGAAGATGTTCCTGGTGGACGACGAAGAGTTCCCGATCCTGGAGTTGCGGAAACTCGAATTCCACCCGC
GGCAAACGGACTCCGACGAACATGCCCCTACGCAATGA
 Primer design