SecReT6
Protein ID: 116619377
SecReT6 ID153
T6SS typei4b
Gene symbol-
Locus tagAcid_0235
StrainCandidatus Solibacter usitatus Ellin6076
Repliconchromosome [GenBank: NC_008536] [Browse all T6SS(s) in this replicon]
Location [Strand]316264..318090 [+]
ProductImpA domain-containing protein
NoteTssA
UniProt IDQ02CG8
KEGG IDsus:Acid_0235
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 5.20E-23, Aligned region: 53..112
ImpA-rel_N [PF06812], Evalue: 5.20E-23, Aligned region: 206..229
Protein Sequence: 608 a.a.     [Download]
>gi|116619377|ref|YP_821533.1| unnamed protein product [Candidatus Solibacter usitatus Ellin6076]
MPLRNDLLNAIPGENPSGQNLKYAPVFDKIKEARREDDDAAQGEWKRERKLADWPQVVKLSGESLATKTK
DLQLGVWLTEALLKTQGIGGLREGLDLLKGLVEGFWDTLYPEIEDGDLELRAAPLEWIGSRLGQAVKDAP
ITKGRLSWFVYKESRKIPTEADAGGAETKAEARAAAIAEGKITPEEFDTSFESSPKAYYVQLSADYEGTL
ESLQALDELCAEKFQDVAPGFGPLRNTIEEVQQAVRVFLQKKREKEPDEPVEGAESEAAEPPIEELPEVA
TAAESAAAPARARKAGAALSAEPADRSDAIARVLSAAKFLRAENQYDPAPYLLLRGLRWGELRAAGSEID
ASLLAAPPSDLRQDLKRLALEGNWTEVLEAAERGMGMECGRGWLDLQRYVGRASYELGSYYEPIRAAVIS
GVRGFLADYPQLPELTLMDDTPTANAETLAWLKEYVIVAPAPAEAAYAAVAFTDGEAASGSGADAGPDTF
DLAMQAARSGRPQEGIEMLMREMAQERNGRARFHRKVQLTQLCISTGHEAIAVPILQELAAEIERRKLED
WESSELLAQPLALLYRCLAKDEGSADACQKLYSWICRLDPVQAMNVAR
 
Nucleotide Sequence: 1827 bp     [Download]
>gi|116619145|ref|NC_008536.1|:316264-318090 Candidatus Solibacter usitatus Ellin6076 chromosome, complete genome
ATGCCCCTACGCAATGATCTTCTCAACGCAATTCCGGGAGAGAATCCGAGCGGTCAGAACCTAAAGTACG
CTCCTGTATTCGACAAGATCAAAGAGGCGCGGCGGGAAGATGACGACGCCGCACAAGGCGAATGGAAGCG
TGAGCGCAAGCTCGCGGACTGGCCGCAGGTCGTCAAGCTCTCCGGGGAGTCTCTCGCCACCAAGACCAAG
GACCTGCAACTGGGCGTGTGGCTGACCGAGGCGTTGCTCAAGACGCAAGGCATCGGCGGCCTGCGCGAGG
GCCTGGATCTGCTCAAGGGCCTGGTGGAAGGCTTCTGGGATACTCTCTACCCCGAGATCGAAGACGGCGA
CCTGGAACTGCGCGCGGCTCCGCTGGAATGGATCGGCAGCCGTCTGGGACAAGCGGTAAAGGACGCGCCG
ATCACCAAGGGCCGCCTCAGCTGGTTCGTCTACAAAGAGTCCCGCAAAATTCCCACCGAGGCCGACGCCG
GAGGAGCGGAAACCAAAGCGGAAGCCCGCGCAGCCGCGATCGCCGAGGGGAAAATTACGCCCGAGGAGTT
CGACACCAGCTTCGAGAGTTCGCCGAAGGCCTACTATGTGCAATTGTCCGCGGACTACGAGGGCACGCTG
GAGTCCTTGCAGGCGTTGGACGAGCTCTGCGCGGAAAAATTTCAGGATGTGGCTCCCGGGTTTGGACCCC
TGCGCAATACCATCGAGGAAGTCCAGCAGGCTGTCCGCGTATTCCTGCAGAAGAAGCGGGAGAAGGAACC
GGACGAGCCCGTAGAAGGGGCGGAGTCGGAAGCGGCTGAGCCCCCAATTGAAGAGCTCCCGGAGGTAGCG
ACCGCCGCGGAATCGGCGGCCGCGCCGGCGCGTGCCAGGAAAGCCGGCGCAGCGCTCTCGGCCGAGCCGG
CGGACCGGAGCGATGCTATCGCCCGCGTGCTCTCCGCGGCCAAATTTCTGCGCGCCGAAAACCAGTACGA
TCCCGCGCCCTACCTGCTGTTGCGCGGCCTGCGTTGGGGCGAACTGCGCGCCGCGGGAAGCGAGATCGAC
GCGTCTTTGCTGGCCGCTCCGCCCTCGGATCTCCGGCAGGATCTCAAGCGGCTTGCGTTGGAAGGCAACT
GGACGGAAGTGCTGGAAGCGGCCGAGCGCGGCATGGGGATGGAGTGCGGCCGTGGTTGGCTCGATCTGCA
GCGCTATGTCGGCCGCGCCTCCTACGAGTTGGGCTCTTACTACGAGCCCATCCGCGCCGCGGTGATCTCC
GGCGTGCGCGGCTTCCTGGCGGACTATCCGCAGCTGCCGGAACTGACCCTAATGGACGATACTCCCACGG
CCAATGCCGAGACCCTGGCCTGGCTGAAGGAGTATGTAATCGTCGCGCCCGCTCCCGCCGAAGCGGCCTA
CGCGGCCGTGGCGTTCACGGATGGCGAAGCCGCGAGTGGGTCCGGAGCTGATGCAGGGCCGGATACTTTC
GACCTCGCCATGCAGGCCGCACGCTCCGGCCGCCCTCAAGAGGGGATCGAAATGTTGATGCGCGAAATGG
CGCAGGAACGCAATGGCCGCGCCCGCTTCCACCGCAAGGTCCAGCTTACGCAGCTCTGCATCAGCACGGG
GCACGAGGCTATCGCGGTGCCGATTCTACAGGAATTGGCCGCCGAAATCGAACGCCGCAAGCTGGAAGAT
TGGGAGTCGTCGGAGCTGCTGGCGCAGCCGCTGGCCCTTCTCTACCGCTGTCTGGCGAAGGACGAGGGGA
GCGCCGACGCCTGTCAGAAACTGTATTCCTGGATTTGCCGCCTGGACCCGGTGCAGGCGATGAACGTGGC
GAGATAG
 Primer design