SecReT6
Protein ID: 116619378
SecReT6 ID153
T6SS typei4b
Gene symbol-
Locus tagAcid_0236
StrainCandidatus Solibacter usitatus Ellin6076
Repliconchromosome [GenBank: NC_008536] [Browse all T6SS(s) in this replicon]
Location [Strand]318094..318594 [+]
Producthypothetical protein
NoteTssE
UniProt IDQ02CG7
KEGG IDsus:Acid_0236
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 7.30E-21, Aligned region: 38..143
Protein Sequence: 166 a.a.     [Download]
>gi|116619378|ref|YP_821534.1| unnamed protein product [Candidatus Solibacter usitatus Ellin6076]
MARWEPEQTVTQSVLDRLIDRDPASTSETPPTRAQSVRHLKVSLRRDLELLLNSRRTPEAAGSEYEELEK
SLYNFGLPDVTSLSWDSARDRARLARMIEKTLSTFEPRLSGVRVVAVEATTGAQHVMRFQIEGMLDMDPS
PEPISFDTLLQLSSGEYQVKGDLGAG
 
Nucleotide Sequence: 501 bp     [Download]
>gi|116619145|ref|NC_008536.1|:318094-318594 Candidatus Solibacter usitatus Ellin6076 chromosome, complete genome
ATGGCGCGATGGGAGCCGGAACAGACGGTTACGCAGTCGGTGCTGGACAGGCTGATCGACCGTGACCCCG
CCAGCACTTCCGAAACCCCGCCGACGCGCGCGCAATCGGTGCGGCACTTGAAGGTTTCGCTGCGCCGGGA
TCTGGAATTGCTCTTGAATTCGCGGCGCACTCCCGAGGCGGCGGGCAGCGAGTACGAGGAGCTAGAGAAG
TCTTTGTACAACTTCGGGCTGCCCGATGTGACCTCGCTGAGTTGGGATTCGGCGCGCGACCGGGCCCGGC
TGGCGCGGATGATTGAAAAGACCCTGAGCACCTTCGAACCGCGCCTGAGCGGCGTTCGAGTGGTGGCGGT
GGAAGCGACCACCGGCGCACAGCACGTGATGCGTTTTCAAATCGAGGGAATGCTGGATATGGATCCCTCG
CCCGAACCGATTTCCTTCGATACGCTGCTGCAGCTCTCCAGCGGCGAGTATCAGGTCAAGGGGGATTTGG
GTGCGGGATGA
 Primer design