SecReT6
Protein ID: 116619379
SecReT6 ID153
T6SS typei4b
Gene symbol-
Locus tagAcid_0237
StrainCandidatus Solibacter usitatus Ellin6076
Repliconchromosome [GenBank: NC_008536] [Browse all T6SS(s) in this replicon]
Location [Strand]318584..320425 [+]
Producthypothetical protein
NoteTssF
UniProt IDQ02CG6
KEGG IDsus:Acid_0237
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 1.10E-214, Aligned region: 5..613
Protein Sequence: 613 a.a.     [Download]
>gi|116619379|ref|YP_821535.1| unnamed protein product [Candidatus Solibacter usitatus Ellin6076]
MRDDLLLYYERELTFLRQMGAEFAAKYPKVASRLVIEPDKCEDPHVERLLEAFAFLTARVHLKIDDEFPE
ITEGLLNILHPHYLRPIPSMSVAEFQVEPSQAPPEGGLKLPRGAVLNSRPVNGVPCKFRTCYDLTFWPVE
VTDAEWKTPDRLQPPVKSVDTVAAVRVVLKCPGELTFAKLGLSSLRFYLNGESNLVHTLYELLCNQCAHI
IIRDLSPKSKTQPVILTGDALRPVGFGEDEGMLPYARRSFVGYRLLQEYFCFPQKFFFLDLTGLDRICEA
GFGGQVEVLFMISPFERGERRQMLELGVSAKTFRLGCAPIVNLFAQTAEPILLSHMRYEYPIVPDVSRRR
ASEVFEITEVQSANPQSGEVVRFEPFYSYRHGSNRATTQAFWRASRRASGRRDDDSTEVFLSLVDLSSRP
VRPNVEALVVRTICSNRDLPSRLPFGNEAGDFELEGAIPVKRIVALIKPTDALRPPVGKDSMWRLVSQLS
LNYLSLVENGREALQEILRLYNFAESTHFEKQIQGLVALDSRRHFARVISDDGVVFARGTQVDMEFDEEQ
FVGGGVYLFASVLEHFLGLYVSMNSFSRLRVRTRQRKEVLRQWPPRAGQKILL
 
Nucleotide Sequence: 1842 bp     [Download]
>gi|116619145|ref|NC_008536.1|:318584-320425 Candidatus Solibacter usitatus Ellin6076 chromosome, complete genome
GTGCGGGATGACCTGCTGCTCTACTACGAGCGCGAACTGACCTTCCTGCGCCAGATGGGGGCGGAGTTTG
CCGCCAAGTATCCCAAGGTGGCTTCGCGGCTGGTGATAGAGCCGGATAAGTGCGAAGACCCGCACGTGGA
ACGCCTGCTGGAAGCATTTGCATTCCTCACGGCTCGGGTCCACCTCAAGATCGACGACGAATTTCCGGAG
ATCACCGAGGGCCTGCTCAATATTCTCCACCCGCACTACCTGCGGCCGATTCCCTCCATGTCGGTCGCGG
AGTTTCAGGTGGAACCGTCCCAGGCGCCGCCAGAGGGCGGTTTGAAACTGCCGCGAGGGGCGGTATTGAA
CTCGCGGCCGGTGAACGGAGTGCCCTGCAAATTTCGTACCTGCTACGACCTGACGTTTTGGCCCGTCGAG
GTTACCGACGCCGAGTGGAAGACGCCGGACCGCCTGCAGCCTCCGGTCAAGTCCGTCGACACGGTGGCCG
CGGTACGCGTGGTTTTGAAATGTCCCGGGGAATTGACGTTTGCCAAGCTGGGGCTTTCTTCCCTGCGCTT
CTATCTGAATGGCGAAAGCAATCTGGTCCACACGCTGTATGAGCTGTTGTGCAACCAGTGCGCGCATATC
ATCATCCGCGACCTGTCTCCAAAATCGAAGACGCAACCGGTGATTCTGACCGGGGACGCGCTGCGGCCCG
TGGGGTTTGGCGAAGACGAAGGGATGCTGCCCTACGCGCGCCGGTCCTTCGTGGGCTACCGGCTGCTGCA
GGAATACTTCTGCTTCCCGCAGAAGTTCTTCTTCCTGGACCTGACGGGGCTGGACCGGATTTGCGAAGCC
GGCTTCGGCGGTCAGGTGGAAGTCCTGTTCATGATTTCGCCGTTCGAGCGCGGCGAGCGCCGCCAGATGC
TGGAACTCGGGGTGAGCGCCAAGACGTTTCGCCTGGGCTGCGCGCCAATCGTCAACCTGTTCGCGCAAAC
GGCGGAGCCCATTCTGCTGAGCCACATGCGCTACGAATACCCGATCGTGCCCGACGTCAGCCGCCGCCGG
GCCAGTGAGGTCTTTGAGATCACCGAGGTGCAGAGCGCCAATCCTCAATCGGGCGAGGTGGTCCGGTTCG
AGCCGTTCTATTCCTATCGCCACGGATCAAATCGCGCTACGACCCAGGCGTTCTGGCGTGCCTCAAGGCG
CGCCTCGGGACGCCGCGACGACGACTCCACGGAAGTCTTTCTCTCCCTGGTGGATCTTTCGTCACGGCCG
GTGCGGCCGAACGTGGAAGCGCTCGTGGTGCGCACCATCTGCAGCAACCGGGATCTACCCTCGCGGCTGC
CGTTCGGTAATGAGGCGGGAGATTTCGAACTCGAGGGCGCGATTCCGGTGAAGCGCATCGTCGCGTTGAT
CAAGCCCACCGATGCGCTGCGCCCGCCGGTGGGCAAGGACTCCATGTGGCGCCTGGTGTCGCAACTGTCG
CTTAACTATCTGTCCTTGGTCGAAAACGGCCGCGAGGCGTTGCAGGAAATCCTGCGGCTCTACAACTTCG
CGGAGTCCACTCACTTCGAGAAGCAGATTCAAGGCCTGGTGGCGTTAGACAGCCGGCGGCACTTCGCGCG
CGTGATCTCCGATGACGGCGTCGTGTTCGCGCGCGGAACCCAGGTTGACATGGAGTTCGACGAGGAACAG
TTCGTGGGCGGCGGCGTCTATCTCTTCGCCTCGGTGCTGGAGCATTTTCTGGGCCTGTACGTTTCGATGA
ACAGTTTCAGCCGGCTCCGCGTGCGCACCCGGCAGCGGAAGGAGGTTCTGCGACAGTGGCCACCACGAGC
GGGTCAGAAAATACTGCTCTAG
 Primer design