SecReT6
Protein ID: 116619380
SecReT6 ID153
T6SS typei4b
Gene symbol-
Locus tagAcid_0238
StrainCandidatus Solibacter usitatus Ellin6076
Repliconchromosome [GenBank: NC_008536] [Browse all T6SS(s) in this replicon]
Location [Strand]320497..321423 [+]
Producthypothetical protein
NoteTssG
UniProt IDQ02CG5
KEGG IDsus:Acid_0238
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 6.00E-106, Aligned region: 3..293
Protein Sequence: 308 a.a.     [Download]
>gi|116619380|ref|YP_821536.1| unnamed protein product [Candidatus Solibacter usitatus Ellin6076]
MSRMAPGRQVVGRFTNPASEVVRLASHPGVAFPASEIQSLERTGDDPPVMRVNFLGLQGPLGVLPRSYCE
LVNERIRARDTTLRDFFDLFNHRILSLFYQAWEKYQFQIPYERGERDRFSHYVLALLGLDTPGLQHRQDV
ADDSLLYYGGLLGLHSRSATGLRQVLWDYFDVPVEIEQFVGAWYPVDVESQCCLGETGGYSEQLGFGAVV
GDETWDQQSRVRIQLGPLTLEQYVDFLPGHEGHRELRSLTRFYTGGECDVEVQLILRRQDVPACELKPRD
GEGQQLGWTSWINSAEFEHDAGETVLEL
 
Nucleotide Sequence: 927 bp     [Download]
>gi|116619145|ref|NC_008536.1|:320497-321423 Candidatus Solibacter usitatus Ellin6076 chromosome, complete genome
ATGTCGCGGATGGCGCCCGGGCGCCAGGTGGTGGGGCGTTTCACCAACCCCGCCAGCGAAGTGGTGCGCC
TCGCATCTCATCCGGGCGTGGCGTTTCCCGCCAGCGAAATTCAGTCGCTGGAGCGGACCGGAGATGATCC
TCCGGTGATGCGGGTGAACTTTCTCGGTCTGCAGGGCCCCCTGGGCGTGCTGCCGCGCTCCTATTGCGAA
CTAGTCAATGAGCGGATTCGCGCGCGCGACACCACGCTGCGGGACTTCTTCGATCTCTTCAACCACCGGA
TCCTCTCGCTGTTTTACCAGGCTTGGGAGAAATACCAGTTTCAGATTCCGTATGAGCGCGGCGAGCGCGA
CCGGTTTTCGCACTATGTGCTGGCACTCCTCGGGCTGGATACGCCCGGTCTGCAGCACCGCCAGGACGTG
GCGGACGATTCCCTGCTTTACTACGGCGGGCTGCTCGGCCTGCATTCGCGCTCTGCCACCGGTTTGCGCC
AGGTGCTGTGGGACTACTTCGACGTTCCGGTGGAGATCGAGCAGTTCGTGGGTGCGTGGTACCCGGTGGA
CGTAGAATCGCAGTGCTGCCTCGGCGAGACCGGCGGCTATTCGGAACAGTTGGGGTTTGGCGCGGTGGTG
GGCGATGAGACCTGGGACCAGCAATCCCGAGTGCGCATCCAACTCGGGCCGCTGACCCTGGAACAGTATG
TGGACTTCCTGCCCGGCCACGAGGGGCATCGCGAGTTGCGCTCGCTCACGCGGTTCTACACCGGCGGAGA
ATGCGATGTGGAAGTACAGTTGATCCTTCGGAGGCAGGATGTTCCAGCCTGCGAGTTGAAACCGCGGGAT
GGCGAAGGGCAGCAACTGGGCTGGACCAGCTGGATCAACTCAGCGGAGTTTGAGCACGACGCCGGGGAAA
CGGTACTCGAGTTATAG
 Primer design