SecReT6
Protein ID: 116619381
SecReT6 ID153
T6SS typei4b
Gene symbol-
Locus tagAcid_0239
StrainCandidatus Solibacter usitatus Ellin6076
Repliconchromosome [GenBank: NC_008536] [Browse all T6SS(s) in this replicon]
Location [Strand]321443..324115 [+]
ProductATPase
NoteTssH
UniProt IDQ02CG4
KEGG IDsus:Acid_0239
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 2.00E-42, Aligned region: 228..248
AAA_2 [PF07724], Evalue: 2.00E-42, Aligned region: 623..790
AAA [PF00004], Evalue: 1.70E-20, Aligned region: 228..360
AAA [PF00004], Evalue: 1.70E-20, Aligned region: 629..747
AAA_5 [PF07728], Evalue: 3.60E-16, Aligned region: 228..307
AAA_5 [PF07728], Evalue: 3.60E-16, Aligned region: 628..749
ClpB_D2-small [PF10431], Evalue: 2.60E-14, Aligned region: 798..869
AAA_16 [PF13191], Evalue: 6.30E-12, Aligned region: 206..249
AAA_16 [PF13191], Evalue: 6.30E-12, Aligned region: 272..306
AAA_16 [PF13191], Evalue: 6.30E-12, Aligned region: 414..512
AAA_16 [PF13191], Evalue: 6.30E-12, Aligned region: 619..672
AAA_16 [PF13191], Evalue: 6.30E-12, Aligned region: 693..717
AAA_22 [PF13401], Evalue: 9.20E-09, Aligned region: 227..314
AAA_22 [PF13401], Evalue: 9.20E-09, Aligned region: 345..387
AAA_22 [PF13401], Evalue: 9.20E-09, Aligned region: 627..650
AAA_22 [PF13401], Evalue: 9.20E-09, Aligned region: 689..722
Sigma54_activat [PF00158], Evalue: 1.30E-07, Aligned region: 213..244
Sigma54_activat [PF00158], Evalue: 1.30E-07, Aligned region: 628..750
AAA_14 [PF13173], Evalue: 2.20E-06, Aligned region: 228..361
AAA_14 [PF13173], Evalue: 2.20E-06, Aligned region: 627..709
AAA_14 [PF13173], Evalue: 2.20E-06, Aligned region: 831..872
AAA_29 [PF13555], Evalue: 1.90E-05, Aligned region: 221..244
AAA_29 [PF13555], Evalue: 1.90E-05, Aligned region: 626..654
IstB_IS21 [PF01695], Evalue: 3.10E-05, Aligned region: 222..265
IstB_IS21 [PF01695], Evalue: 3.10E-05, Aligned region: 628..646
IstB_IS21 [PF01695], Evalue: 3.10E-05, Aligned region: 739..759
Zeta_toxin [PF06414], Evalue: 3.50E-05, Aligned region: 223..248
Zeta_toxin [PF06414], Evalue: 3.50E-05, Aligned region: 622..668
AAA_19 [PF13245], Evalue: 4.30E-05, Aligned region: 228..250
AAA_19 [PF13245], Evalue: 4.30E-05, Aligned region: 626..650
AAA_17 [PF13207], Evalue: 6.40E-05, Aligned region: 228..270
AAA_17 [PF13207], Evalue: 6.40E-05, Aligned region: 531..560
AAA_17 [PF13207], Evalue: 6.40E-05, Aligned region: 627..664
Arch_ATPase [PF01637], Evalue: 6.60E-05, Aligned region: 207..248
Arch_ATPase [PF01637], Evalue: 6.60E-05, Aligned region: 280..310
Arch_ATPase [PF01637], Evalue: 6.60E-05, Aligned region: 627..648
Arch_ATPase [PF01637], Evalue: 6.60E-05, Aligned region: 698..723
NACHT [PF05729], Evalue: 0.00046, Aligned region: 228..255
NACHT [PF05729], Evalue: 0.00046, Aligned region: 628..653
RNA_helicase [PF00910], Evalue: 0.0027, Aligned region: 229..249
RNA_helicase [PF00910], Evalue: 0.0027, Aligned region: 629..650
RNA_helicase [PF00910], Evalue: 0.0027, Aligned region: 725..746
AAA_23 [PF13476], Evalue: 0.0064, Aligned region: 228..244
AAA_23 [PF13476], Evalue: 0.0064, Aligned region: 626..654
T2SE [PF00437], Evalue: 0.0073, Aligned region: 203..248
T2SE [PF00437], Evalue: 0.0073, Aligned region: 624..698
AAA_18 [PF13238], Evalue: 0.0081, Aligned region: 228..248
AAA_18 [PF13238], Evalue: 0.0081, Aligned region: 629..653
DUF815 [PF05673], Evalue: 0.0086, Aligned region: 218..303
DUF815 [PF05673], Evalue: 0.0086, Aligned region: 623..668
AAA_25 [PF13481], Evalue: 0.0088, Aligned region: 228..292
AAA_25 [PF13481], Evalue: 0.0088, Aligned region: 626..646
SRP54 [PF00448], Evalue: 0.0098, Aligned region: 228..248
SRP54 [PF00448], Evalue: 0.0098, Aligned region: 627..658
Protein Sequence: 890 a.a.     [Download]
>gi|116619381|ref|YP_821537.1| unnamed protein product [Candidatus Solibacter usitatus Ellin6076]
MANILKAIVGRLNDTMRTTLEGAAGLCLARTHYDVEIEHVLTKLLEAGGTDFAGILQHFDVDKTRLSGEL
ARSLDKLKSGNARTPAFSPSLLRMLREAWTVGSLEFGAGQVRSGTAILALVSDAELSRLVHDVSKEFRKI
ESEALRKVLPAILEDSRESSAEADAMPASGASSTGAPKAGGKTPNLDQFTVNLTENARQGKTDTVLGRDS
EIRQMVDILTRRRQNNPILTGEAGVGKTAVVEGFAQRIVAGDVPPSLRNVTVRSLDLTLLQAGAGIKGEF
ENRLKSLVEEVKSSPTPIILFIDEAHTMIGAGGTAGQNDAANILKPALARGELRTIAATTWSEYKKYFEK
DPALARRFQVVKVEEPTEAKCQVMLRGLVPVLEKHHNVRILDEGLVAAVKFSHRYLADRQLPDKAVSVLD
TACARLSLGQNATPPAIEDAIRQIDDCTVQTRILERESALGADHAEGLAALAKQKAAEEGRLADLQQRWQ
KERDLVGKIREVRGKLETAAGAPVAATEGAAAAVQTAVDPDALRAELAGLNAELEQLQGESPLMRVCVDG
QIVGEVVAAWTGIPIGKMLRDEMQSILSLESHLGRRVIGQDHALGMLSERIRTSKAGLEDPGKPVGVFLL
VGPSGVGKTETATAMADLLYGGERNMITINMSEFQEAHTVSTLKGSPPGYVGYGEGGVLTEAVRRRPYSV
VLLDEVEKAHPDVLELFFQVFDKGKMEDGEGREIDFKNTIIILTSNAATDTLMKLTADPETMPSPAGLVK
AIKPELNKVFKPAFLGRLVIIPYFPVRDEALKMIVRLKLGKIQRRIQETHRIAITYDEPLIEEVAKRCTE
VESGARNVDNILTNTLLPEISRRILGHLAERQKPAPIHVTIGGSGEFVYQ
 
Nucleotide Sequence: 2673 bp     [Download]
>gi|116619145|ref|NC_008536.1|:321443-324115 Candidatus Solibacter usitatus Ellin6076 chromosome, complete genome
ATGGCGAATATTTTGAAGGCGATCGTTGGCAGGCTGAACGATACCATGCGCACGACGCTTGAGGGAGCGG
CCGGCCTGTGCCTGGCACGGACCCATTATGACGTTGAGATCGAACACGTCCTGACCAAACTGCTGGAAGC
CGGCGGCACGGATTTCGCCGGCATCCTGCAGCACTTCGACGTGGATAAGACGCGGCTCTCCGGCGAGCTC
GCGCGCAGCCTCGACAAACTCAAGAGCGGCAACGCGCGCACGCCCGCGTTCAGTCCGTCGCTGCTCCGCA
TGCTTCGCGAGGCCTGGACCGTCGGATCGCTGGAGTTTGGCGCCGGGCAGGTGCGCTCCGGCACGGCCAT
CCTGGCGCTGGTGTCGGATGCCGAGCTGTCGCGGCTGGTCCACGATGTCAGCAAGGAGTTCCGCAAGATC
GAGTCCGAGGCGTTGCGGAAAGTACTGCCGGCGATCCTCGAGGATTCGCGCGAATCGTCCGCGGAAGCGG
ACGCGATGCCGGCTTCGGGCGCGAGCTCGACGGGCGCCCCGAAGGCGGGCGGCAAGACGCCCAACCTGGA
TCAATTCACCGTGAACCTCACCGAAAACGCGCGCCAGGGAAAGACCGACACGGTGCTGGGCCGGGATTCC
GAGATCCGTCAGATGGTGGACATCCTCACCCGGCGGCGGCAGAACAACCCGATCCTCACCGGAGAAGCGG
GCGTTGGCAAAACCGCCGTGGTGGAGGGTTTCGCGCAGCGGATCGTGGCCGGCGACGTGCCGCCCAGTCT
GCGTAACGTCACCGTCCGCTCGCTTGACCTGACGCTCTTGCAGGCCGGCGCCGGAATTAAAGGCGAGTTC
GAGAACCGTCTCAAGAGCCTGGTGGAGGAGGTCAAGTCGTCGCCCACACCGATCATTCTATTCATCGACG
AAGCCCACACCATGATCGGAGCCGGCGGGACCGCCGGACAAAACGACGCAGCCAACATTCTGAAGCCTGC
GCTGGCGCGCGGCGAACTGCGCACCATCGCCGCCACTACCTGGTCGGAATACAAGAAGTACTTCGAAAAG
GACCCGGCGCTGGCGCGGCGCTTCCAGGTGGTCAAGGTGGAGGAGCCCACGGAAGCCAAGTGCCAGGTGA
TGCTGCGCGGCCTGGTTCCGGTGTTGGAGAAGCACCACAACGTGCGCATCCTCGACGAGGGCTTGGTCGC
GGCAGTCAAGTTCTCGCACCGCTATCTCGCCGACCGGCAGCTTCCCGATAAGGCCGTGAGCGTACTCGAC
ACGGCATGCGCGCGCCTTTCCCTTGGGCAGAACGCCACGCCGCCTGCCATCGAAGACGCCATCCGCCAGA
TCGACGATTGCACGGTGCAGACGCGCATTCTGGAGCGGGAATCCGCGCTGGGAGCAGACCATGCCGAGGG
TTTGGCGGCGCTGGCCAAACAGAAGGCGGCAGAGGAAGGCCGCCTGGCGGATTTACAGCAGCGCTGGCAG
AAGGAGCGCGACTTGGTCGGCAAGATCCGCGAGGTCCGCGGCAAGCTGGAGACCGCAGCCGGCGCACCCG
TCGCGGCAACCGAAGGCGCCGCCGCAGCGGTGCAAACCGCCGTCGATCCGGATGCCCTGCGTGCGGAACT
GGCTGGCTTGAATGCCGAACTGGAACAGCTTCAGGGTGAGAGTCCGCTGATGCGGGTCTGCGTGGATGGA
CAGATCGTGGGCGAGGTGGTGGCCGCTTGGACGGGCATTCCGATCGGCAAGATGCTCCGCGATGAGATGC
AGTCGATCCTCTCGCTGGAATCGCACCTGGGCCGCCGGGTAATCGGGCAGGATCACGCGCTCGGCATGCT
CAGCGAGCGGATTCGTACCTCGAAAGCCGGGTTGGAAGATCCCGGCAAACCGGTCGGCGTTTTCCTGCTG
GTGGGACCGAGCGGCGTCGGCAAGACCGAGACCGCGACGGCGATGGCCGACCTGCTCTACGGCGGCGAGC
GCAACATGATCACCATCAACATGTCGGAGTTCCAGGAAGCGCATACGGTGTCCACGCTGAAGGGCTCGCC
TCCCGGCTATGTCGGTTATGGCGAGGGCGGCGTCCTGACCGAAGCCGTGCGGCGCCGGCCGTATTCGGTG
GTGCTGCTGGACGAGGTGGAGAAGGCGCATCCGGATGTTCTGGAGCTTTTCTTCCAGGTATTCGACAAAG
GCAAGATGGAAGATGGCGAAGGCCGTGAGATCGATTTCAAAAACACCATCATCATCCTCACATCCAACGC
CGCCACAGATACTCTGATGAAGCTCACCGCGGACCCGGAAACCATGCCGAGTCCCGCCGGGCTGGTGAAG
GCCATCAAGCCGGAGTTGAATAAAGTCTTCAAACCGGCCTTCCTGGGACGCCTGGTGATCATTCCCTACT
TTCCTGTTCGCGACGAAGCCTTGAAGATGATCGTCCGCCTGAAGCTGGGGAAAATTCAGCGCCGCATTCA
GGAGACGCACCGCATCGCCATCACTTATGACGAGCCGCTTATCGAAGAAGTGGCAAAGCGCTGCACGGAA
GTCGAGAGCGGAGCCCGCAACGTAGACAACATTCTGACCAATACTTTGTTGCCGGAGATCTCGCGCCGCA
TCCTAGGGCATCTCGCGGAACGGCAAAAGCCGGCGCCGATTCACGTCACGATTGGCGGCAGCGGAGAGTT
TGTGTACCAATAA
 Primer design