SecReT6
Protein ID: 116619382
SecReT6 ID153
T6SS typei4b
Gene symbol-
Locus tagAcid_0240
StrainCandidatus Solibacter usitatus Ellin6076
Repliconchromosome [GenBank: NC_008536] [Browse all T6SS(s) in this replicon]
Location [Strand]324146..326167 [+]
ProductRhs element Vgr protein
NoteTssI
UniProt IDQ02CG3
KEGG IDsus:Acid_0240
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 3.20E-61, Aligned region: 28..355
Phage_base_V [PF04717], Evalue: 3.70E-23, Aligned region: 394..487
Gp5_C [PF06715], Evalue: 9.50E-05, Aligned region: 257..264
Gp5_C [PF06715], Evalue: 9.50E-05, Aligned region: 536..550
Gp5_C [PF06715], Evalue: 9.50E-05, Aligned region: 554..577
Gp5_C [PF06715], Evalue: 9.50E-05, Aligned region: 581..605
Gp5_C [PF06715], Evalue: 9.50E-05, Aligned region: 656..667
Protein Sequence: 673 a.a.     [Download]
>gi|116619382|ref|YP_821538.1| unnamed protein product [Candidatus Solibacter usitatus Ellin6076]
MFAHTDRPLKLTTPLGADALILFHFQGREAISEVFHFELKAVWENKSTLLPFDQLLGKKVTVEVSSPKNK
RYFNGIVCKVTQYSQDQTFTYYYLEVVPELWLLDRKLCSRTFQHLNVPDILKKVLTGLDLDFQIEGTFQP
REYCVQYRESDLAFASRLMEEEGIYYFFKHSASGHQMVLANEPKSHAAIPYLASVTFEEKSHAPLEENRV
FEWSKGQEIRSGKFTAWDHTFEMPTKNLEATKAIQESVAVGTVTHKLKVANNESLELYDYPGGYASRFDG
VNKSGGDQASDLQHIFEDNQRTVGIRMQEEALSSLLIRGKGAHAGFTAGHTFELTEHYSDNGKFVLTGVE
HEAEQALLADDREERFQYSNRFTCIPAALPFRPPRVTPLPTVRGVQTAIVVGPAGEEIFVDKYSRVKVQF
QWDREGTDDVNSSCWVRVATYWAGAQWGSIHIPRIGQEVIVDFLEGNVNCPIIVGSVYNADTMPPWTLPD
NKTVSGYKSRSTPHGTADNFNMISFEDKKGSELVHVQAEKDLLTLVKNNESREVDHDRVTVIKHDETQTV
TNNETITVEQGNQAIEIKQGNQSTTLDMGNQSTKIKMGNQTNNVDLGKIETEAMQSIELKVGQSSIKIDQ
MGVTIKGMMISIEAQVQCEVKAVMTQVNGDAMTIVKGGVVMIN
 
Nucleotide Sequence: 2022 bp     [Download]
>gi|116619145|ref|NC_008536.1|:324146-326167 Candidatus Solibacter usitatus Ellin6076 chromosome, complete genome
ATGTTCGCACATACAGACCGGCCCCTGAAGCTAACTACACCCCTCGGCGCCGACGCTTTGATCTTGTTTC
ACTTTCAAGGGCGGGAAGCCATCTCCGAAGTGTTTCATTTCGAGCTGAAAGCGGTCTGGGAAAATAAAAG
CACACTCCTGCCTTTTGACCAGTTGTTGGGTAAGAAGGTCACAGTGGAGGTCTCCTCCCCGAAGAACAAG
CGTTATTTCAACGGCATCGTCTGCAAGGTCACACAGTACTCACAGGATCAGACCTTCACTTACTACTACC
TGGAGGTAGTGCCCGAACTGTGGCTGCTCGACCGTAAGTTGTGCAGCCGCACGTTCCAGCATCTTAACGT
ACCCGACATTCTCAAAAAGGTGCTGACCGGCCTCGACCTGGACTTTCAGATCGAAGGCACCTTCCAGCCC
CGCGAATACTGCGTGCAATACCGGGAAAGCGATCTCGCGTTCGCCAGCCGTCTGATGGAAGAAGAAGGAA
TTTATTACTTCTTCAAACACTCCGCCAGCGGTCACCAGATGGTGCTGGCGAATGAGCCCAAATCCCACGC
CGCGATTCCCTATCTGGCCAGCGTAACCTTTGAAGAAAAATCGCATGCACCCTTGGAAGAAAACCGCGTG
TTCGAGTGGAGCAAGGGGCAGGAGATCCGCTCGGGTAAGTTCACAGCCTGGGATCACACTTTCGAAATGC
CCACCAAAAACCTGGAAGCCACTAAGGCGATCCAGGAGTCGGTGGCCGTGGGTACCGTCACCCATAAGTT
GAAAGTGGCGAACAACGAAAGCCTCGAACTCTACGACTACCCCGGCGGCTACGCCAGCCGTTTCGATGGC
GTCAATAAATCCGGTGGCGACCAGGCGTCCGACCTGCAGCACATCTTTGAGGACAACCAGCGCACGGTGG
GAATTCGCATGCAGGAAGAGGCTCTCTCCAGCTTGCTCATCCGCGGCAAGGGAGCGCACGCGGGCTTTAC
CGCCGGCCACACCTTTGAACTGACGGAGCATTACTCCGACAATGGCAAGTTCGTGCTCACCGGCGTGGAG
CACGAGGCCGAGCAGGCGTTGCTCGCGGACGATCGGGAAGAGCGATTCCAGTACTCCAACCGCTTTACCT
GCATTCCCGCCGCGCTGCCTTTCCGTCCGCCGCGAGTGACGCCGCTTCCGACTGTGCGCGGCGTGCAGAC
CGCCATCGTGGTGGGGCCCGCGGGAGAGGAGATCTTCGTCGATAAATACAGCCGGGTGAAGGTTCAGTTT
CAGTGGGATCGCGAAGGCACCGATGACGTCAACAGTTCCTGCTGGGTCCGCGTCGCCACCTACTGGGCAG
GGGCGCAATGGGGTAGCATACACATCCCGCGCATTGGCCAGGAAGTGATTGTGGATTTTCTGGAAGGCAA
CGTCAATTGCCCGATCATCGTGGGCAGCGTGTACAACGCCGACACCATGCCTCCGTGGACGCTGCCCGAC
AACAAGACCGTCAGCGGATACAAGTCGCGCAGCACTCCACACGGTACGGCCGATAATTTCAATATGATCT
CGTTCGAAGACAAGAAGGGCAGCGAACTGGTACACGTGCAGGCGGAGAAAGATCTGCTCACGCTGGTGAA
GAACAACGAATCGCGGGAAGTGGACCACGACCGGGTTACGGTGATCAAGCACGATGAAACCCAAACAGTA
ACCAACAACGAGACCATCACCGTGGAGCAGGGCAACCAGGCCATCGAAATCAAGCAAGGCAACCAGAGCA
CGACACTGGACATGGGAAACCAATCCACGAAGATCAAGATGGGGAACCAGACGAACAATGTGGACCTCGG
TAAAATCGAGACCGAGGCGATGCAGTCCATCGAACTTAAGGTGGGCCAGAGCAGCATCAAGATCGATCAG
ATGGGCGTGACCATCAAGGGCATGATGATCTCGATCGAGGCGCAGGTGCAGTGCGAGGTCAAGGCTGTAA
TGACGCAAGTCAACGGCGATGCAATGACGATCGTCAAGGGCGGCGTCGTGATGATCAATTGA
 Primer design