SecReT6
Protein ID: 116619384
SecReT6 ID153
T6SS typei4b
Gene symbol-
Locus tagAcid_0242
StrainCandidatus Solibacter usitatus Ellin6076
Repliconchromosome [GenBank: NC_008536] [Browse all T6SS(s) in this replicon]
Location [Strand]326766..327056 [+]
ProductPAAR repeat-containing protein
NotePAAR
UniProt IDQ02CG1
KEGG IDsus:Acid_0242
PDB IDNA
Domain hit(s) vs Pfam PAAR_motif [PF05488], Evalue: 1.10E-20, Aligned region: 1..16
PAAR_motif [PF05488], Evalue: 1.10E-20, Aligned region: 19..87
DUF4150 [PF13665], Evalue: 0.0026, Aligned region: 2..12
DUF4150 [PF13665], Evalue: 0.0026, Aligned region: 32..51
DUF4150 [PF13665], Evalue: 0.0026, Aligned region: 61..83
Protein Sequence: 96 a.a.     [Download]
>gi|116619384|ref|YP_821540.1| unnamed protein product [Candidatus Solibacter usitatus Ellin6076]
MGMPASRVTDMHVCPMVTGIVPHVGGPILPPCAVTVLIGGLPAARVGDMATCVGPPDVIALGSFTVFTMK
MPQARMLDTTAHGGKIVLGFPTVLVG
 
Nucleotide Sequence: 291 bp     [Download]
>gi|116619145|ref|NC_008536.1|:326766-327056 Candidatus Solibacter usitatus Ellin6076 chromosome, complete genome
ATGGGAATGCCGGCTTCGAGAGTCACGGACATGCACGTTTGCCCCATGGTGACCGGGATCGTACCGCATG
TAGGCGGGCCAATCCTGCCGCCGTGCGCGGTCACGGTGCTGATCGGAGGCCTGCCCGCGGCGCGGGTAGG
GGACATGGCGACGTGCGTCGGACCTCCGGATGTCATCGCGCTCGGGTCCTTCACGGTGTTCACAATGAAG
ATGCCGCAGGCGCGGATGCTCGACACGACGGCACACGGCGGAAAGATCGTGCTCGGTTTCCCCACCGTGC
TCGTGGGCTGA
 Primer design