SecReT6
Protein ID: 116688483
SecReT6 ID154
T6SS typei4b
Gene symbol-
Locus tagBcen2424_0459
StrainBurkholderia cenocepacia HI2424
Repliconchromosome I [GenBank: NC_008542] [Browse all T6SS(s) in this replicon]
Location [Strand]505362..508553 [+]
ProductRhs element Vgr protein
NoteTssI
UniProt IDA0K3Y6
KEGG IDbch:Bcen2424_0459
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 5.40E-73, Aligned region: 42..353
Phage_GPD [PF05954], Evalue: 5.40E-73, Aligned region: 603..650
DUF2345 [PF10106], Evalue: 4.40E-60, Aligned region: 668..820
DUF2345 [PF10106], Evalue: 4.40E-60, Aligned region: 939..1009
T6SS_Vgr [PF13296], Evalue: 3.40E-37, Aligned region: 524..630
Phage_base_V [PF04717], Evalue: 5.00E-20, Aligned region: 424..514
Phage_base_V [PF04717], Evalue: 5.00E-20, Aligned region: 875..894
Sarcoglycan_1 [PF04790], Evalue: 0.0041, Aligned region: 714..785
Protein Sequence: 1063 a.a.     [Download]
>gi|116688483|ref|YP_834106.1| Rhs element Vgr protein [Burkholderia cenocepacia HI2424]
MNMQNTIAALRGGLLQQDRLLKLDTPLGSNVLTVQRAVGRSRIGRAYEFTLDVLSTDSDLELKKLIAQPV
TLWIQQGDRSYRPMNGYVHTARRLGADGGLTTYQLTFADFTHFLKFRRDQRIWNDTTVDQIISDVLNQHP
QAKGHFRFALSKPLPNRSYTRQHDTDWHFIHRLMEDEGLYCAWQQADDGKSHTLVVTDNLQAFAPLSPQT
VRFYRGGAASEADAFTQWSGTRTLQSVTRSTRTFDYKNPAQPSNPKGTSLPTMAGQGELPDQLEVYEYTG
AYTYLDQTRGDHLTKIRMEQWESEAKRFHGAGGVRAIDAGRRFTLADHPEHDRDPADQREFAAIGVEWWI
ENNLPVSNGSADFPYSLREALTQAQEGYGADPAFRVPHDDGSVGFYLVEVEAQRVNVPYRSPFEHKKPEM
HLETAIVVGPQGEEVYTDELNRTRVQFVWDRLNPGNENASCWVRVVQSDTGGGYGGVHVPRIGEEVLIDY
VGGDCDRPLAVGRVYNGANQPQWHSDGILSGYRSKEYSGGGYNQLVMDDATGQNRVQLMSSSANSLLHLG
YIIDQNGNARGSYLGSGFDLRSDAYGAVRASQGLYVTTHPKAANSQPLDVKEAQQQLVAGESLVEAMSGV
SEQHQAESLKDAQDTMRAFTDATQDSQSGSAAGGRTAGGGTGNANAFKEPVMLFGSPSGIGMSTQQSVHM
VANDHVNVASGQSVHVAAGKSLIGSIGQKLSLFVQNAGMKLFAGKGKVEIQAQSDNIEVTAQKAVRVVSA
TDRIEIAADQGILLTSGGGYIRIKDGDIEIHTPGAVDVKGASHTFAGPASMGYPLPSPRPDQPGQLELFH
KYVNGEAVKGGLFTVKDVNGAVLKKGALDNSGYTVVSGLPPGAVRVEFGKDPRESDQPANYFKQAKWPAE
PVQPSPEAAQAAASGQLASQLQGMAPAATTAAMGLVSGGGAGAALGGLASAALPAAATALGGAGVASALQ
TASSLSGAAKQVAGMVQAARQGGLAALAAPAANAASGALQGALPGALPGVAGIAGKGATTVASAAGATGM
KLPTSGFGGPLKS
 
Nucleotide Sequence: 3192 bp     [Download]
>gi|116688024|ref|NC_008542.1|:505362-508553 Burkholderia cenocepacia HI2424 chromosome 1, complete sequence
ATGAACATGCAGAACACAATCGCCGCATTGCGCGGCGGATTGCTTCAGCAGGACCGGTTGTTGAAGCTCG
ATACGCCATTGGGGAGCAACGTCCTGACCGTGCAGCGGGCAGTTGGCCGCTCACGTATCGGGCGCGCGTA
CGAATTCACGCTGGACGTACTGTCGACCGATAGCGATCTGGAGCTTAAAAAGCTGATCGCGCAGCCGGTC
ACGTTGTGGATTCAGCAAGGCGATCGCAGCTATCGGCCGATGAACGGCTACGTGCACACCGCGCGCCGTC
TGGGCGCCGACGGCGGGCTCACGACCTATCAGCTCACGTTCGCCGATTTCACCCATTTCCTGAAGTTCCG
TCGCGACCAGCGGATCTGGAACGATACGACCGTCGACCAGATCATCAGCGACGTGCTGAACCAGCATCCG
CAGGCGAAAGGCCATTTCCGCTTTGCGCTGTCGAAGCCGTTGCCGAACCGCTCGTACACGCGACAGCACG
ACACCGACTGGCATTTCATCCATCGACTGATGGAGGACGAAGGGCTCTACTGCGCGTGGCAGCAGGCCGA
CGACGGCAAGTCGCACACGCTCGTGGTGACCGACAACCTGCAGGCGTTCGCGCCGCTATCGCCGCAGACC
GTGCGCTTCTATCGTGGCGGGGCGGCGAGCGAAGCCGATGCGTTCACGCAATGGTCGGGCACGCGCACGC
TGCAGAGCGTCACGCGTTCGACGCGCACGTTCGACTACAAGAATCCCGCGCAGCCGTCGAATCCGAAAGG
CACGTCGCTGCCGACGATGGCCGGTCAGGGCGAATTGCCCGATCAGCTCGAAGTCTACGAATACACCGGT
GCGTACACGTATCTGGACCAGACGCGCGGCGACCATCTGACGAAGATCCGGATGGAGCAGTGGGAGTCGG
AGGCGAAGCGCTTCCACGGCGCGGGCGGCGTGCGTGCGATCGATGCCGGCCGGCGCTTCACGCTGGCGGA
TCATCCCGAACACGATCGCGATCCGGCCGACCAGCGCGAATTCGCGGCGATCGGCGTCGAATGGTGGATC
GAGAACAACCTCCCCGTTTCGAACGGCAGCGCGGATTTTCCGTACAGCCTGCGTGAAGCGTTGACGCAAG
CGCAGGAGGGCTACGGTGCCGACCCCGCGTTTCGCGTGCCGCACGACGACGGCTCGGTCGGCTTCTATCT
CGTCGAGGTCGAAGCGCAGCGCGTGAACGTGCCGTATCGCAGCCCGTTCGAGCATAAAAAGCCGGAGATG
CACCTCGAGACGGCGATCGTCGTCGGGCCGCAGGGCGAGGAGGTTTATACCGACGAGCTGAACCGGACTC
GCGTGCAGTTCGTGTGGGATCGCCTGAACCCGGGCAACGAGAACGCATCGTGCTGGGTGCGCGTCGTGCA
GTCGGATACGGGCGGCGGCTACGGCGGTGTGCACGTGCCGCGCATCGGCGAGGAAGTGCTGATCGACTAC
GTCGGCGGCGACTGCGACCGGCCGCTGGCCGTGGGGCGCGTGTACAACGGCGCGAACCAGCCGCAGTGGC
ATAGCGACGGGATTCTGTCCGGCTATCGATCGAAGGAGTATTCGGGCGGCGGCTACAACCAGCTCGTGAT
GGACGACGCGACCGGGCAGAACCGCGTGCAACTGATGAGCAGCAGCGCGAACAGCCTGCTGCATCTCGGC
TACATCATCGACCAGAACGGCAATGCGCGCGGGTCGTATCTGGGCAGCGGTTTCGATCTGCGCTCGGATG
CGTATGGCGCGGTGCGGGCGAGCCAGGGCCTGTACGTGACGACGCACCCGAAGGCGGCGAACAGCCAGCC
GCTCGACGTGAAGGAGGCGCAGCAGCAGCTCGTGGCGGGCGAGAGCCTGGTCGAGGCGATGTCGGGCGTG
AGCGAGCAGCATCAGGCGGAGAGCCTGAAGGACGCGCAGGACACGATGCGTGCATTCACGGACGCGACGC
AGGACAGCCAGTCGGGCAGCGCGGCGGGCGGGCGCACGGCGGGCGGCGGCACCGGTAACGCGAACGCGTT
CAAGGAACCGGTGATGCTGTTCGGCAGCCCGTCGGGAATCGGGATGTCGACGCAGCAGTCGGTGCATATG
GTCGCGAACGATCACGTGAACGTGGCAAGCGGGCAGAGCGTGCACGTGGCCGCGGGCAAGTCGCTGATCG
GCAGCATCGGGCAGAAGCTGAGCCTGTTCGTGCAGAACGCGGGGATGAAGCTGTTCGCGGGCAAGGGCAA
GGTCGAGATCCAGGCGCAGTCGGACAACATCGAGGTGACCGCGCAGAAGGCGGTGAGGGTGGTGTCGGCG
ACGGACCGGATCGAGATCGCGGCCGATCAGGGGATTTTGCTGACGAGCGGCGGCGGATATATCCGCATCA
AGGACGGCGACATCGAGATTCATACGCCGGGCGCGGTCGATGTGAAGGGGGCGTCGCATACGTTCGCGGG
GCCGGCGAGCATGGGGTATCCGCTGCCGAGCCCGCGGCCGGATCAGCCCGGGCAGCTCGAACTGTTTCAC
AAGTACGTGAACGGCGAGGCGGTGAAGGGCGGGCTGTTCACGGTGAAGGACGTGAACGGCGCCGTGCTGA
AGAAAGGCGCACTCGACAACAGCGGCTATACGGTCGTGAGCGGCTTGCCGCCGGGGGCGGTGCGCGTCGA
ATTCGGGAAAGACCCACGCGAGTCGGATCAGCCGGCGAACTATTTCAAGCAGGCGAAGTGGCCGGCGGAG
CCCGTGCAACCGTCGCCCGAGGCCGCGCAGGCCGCGGCGAGCGGACAGCTCGCGAGTCAGCTGCAAGGGA
TGGCGCCGGCCGCGACGACCGCGGCGATGGGGCTGGTGAGCGGCGGCGGCGCGGGTGCGGCCCTCGGCGG
GCTCGCGAGCGCCGCATTGCCGGCTGCTGCGACCGCGTTGGGTGGCGCCGGCGTGGCGTCCGCGTTGCAG
ACCGCCTCGAGCCTGAGCGGTGCGGCGAAGCAGGTGGCCGGGATGGTTCAGGCCGCCCGTCAGGGCGGGC
TTGCCGCGCTTGCCGCGCCGGCTGCGAATGCGGCGTCCGGGGCGTTGCAGGGCGCGTTGCCCGGTGCATT
GCCGGGCGTGGCCGGTATCGCGGGCAAGGGCGCCACGACCGTGGCGTCGGCCGCGGGCGCGACGGGCATG
AAACTGCCGACAAGCGGGTTTGGCGGACCGTTGAAATCCTGA
 Primer design