SecReT6
Protein ID: 116688487
SecReT6 ID154
T6SS typei4b
Gene symbol-
Locus tagBcen2424_0463
StrainBurkholderia cenocepacia HI2424
Repliconchromosome I [GenBank: NC_008542] [Browse all T6SS(s) in this replicon]
Location [Strand]514786..515568 [-]
Producthypothetical protein
NoteTssL
UniProt IDA0K3Z0
KEGG IDbch:Bcen2424_0463
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 2.10E-58, Aligned region: 30..231
Protein Sequence: 260 a.a.     [Download]
>gi|116688487|ref|YP_834110.1| hypothetical protein Bcen2424_0463 [Burkholderia cenocepacia HI2424]
MSYAPSLFGDNVPPPLHSPASTDSAFQARSLLDLLYDGFFMLFLLKNKREPDSASEFSTRIQEFLSDFER
GAKKLNIAAEDVYGAKFAFCAAIDEMVLSSQFKIRADWERRPLQLVLFGEQLAGEKFFQYLEECRAQGAA
RLQSLEVFHMCLLLGFQGKYLLEGPEKLAYLTARLGDEIAHMKGKRAAFAPHWPLPDQIAHRLKREVPVW
AIGTVFALVALLGYLGLNTYLKDKTLQALAPYSQVIKVGPESANLTISLP
 
Nucleotide Sequence: 783 bp     [Download]
>gi|116688024|ref|NC_008542.1|:c515568-514786 Burkholderia cenocepacia HI2424 chromosome 1, complete sequence
ATGAGCTACGCGCCTTCCCTGTTCGGCGACAACGTGCCGCCGCCCCTGCATAGCCCGGCATCGACGGACT
CCGCGTTCCAGGCCCGCTCGCTGCTCGATCTGCTGTACGACGGGTTCTTCATGCTGTTTCTGCTCAAGAA
CAAGCGGGAGCCGGACAGCGCCAGCGAGTTCAGCACGCGGATCCAGGAGTTCCTGTCGGATTTCGAGCGC
GGCGCGAAGAAGCTGAATATCGCCGCCGAGGACGTGTACGGCGCGAAGTTCGCGTTCTGCGCGGCCATCG
ACGAAATGGTGCTGTCGTCGCAGTTCAAGATCCGCGCGGATTGGGAACGCCGGCCGCTGCAGCTCGTGCT
GTTCGGCGAGCAGCTCGCGGGCGAGAAGTTCTTCCAGTATCTCGAGGAGTGTCGTGCGCAGGGTGCGGCG
CGGCTGCAGTCGCTCGAGGTGTTTCATATGTGCCTGCTGCTCGGGTTCCAGGGCAAGTATCTGCTCGAAG
GGCCGGAGAAGCTCGCGTATCTCACCGCGCGGCTTGGGGACGAGATCGCGCATATGAAGGGCAAGCGGGC
TGCGTTTGCGCCGCATTGGCCGCTGCCGGATCAGATCGCGCACCGGTTGAAGCGGGAGGTGCCGGTTTGG
GCGATCGGGACCGTGTTCGCGCTCGTTGCGTTGCTTGGGTATCTCGGGCTCAATACCTATCTCAAGGACA
AGACGCTGCAGGCGTTGGCGCCGTATTCGCAAGTCATCAAAGTGGGCCCGGAGTCGGCTAATTTGACGAT
TTCGTTGCCGTAA
 Primer design