SecReT6
Protein ID: 116688488
SecReT6 ID154
T6SS typei4b
Gene symbol-
Locus tagBcen2424_0464
StrainBurkholderia cenocepacia HI2424
Repliconchromosome I [GenBank: NC_008542] [Browse all T6SS(s) in this replicon]
Location [Strand]515565..516911 [-]
Producthypothetical protein
NoteTssK
UniProt IDA0K3Z1
KEGG IDbch:Bcen2424_0464
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 4.50E-135, Aligned region: 19..446
Protein Sequence: 448 a.a.     [Download]
>gi|116688488|ref|YP_834111.1| hypothetical protein Bcen2424_0464 [Burkholderia cenocepacia HI2424]
MSYSAKVLWGEGLFLRPQHFQRQDAYHEARLFESIQAIQPYNWGVRSVRIDRDALGSNVLRVAELALVFP
DGALYAAPQADDLPPPIALDTLPDGINEFVFYLALHPLRENGTNYSDDPAAGFMTRFVSEQTSVADNFTD
AAEADITFLKTQVKLIAHSEPRDQLLSVPLVRVRRTATSGFEIDDSFVPPCLAIEASPILHQRLRQLVDA
LQAKVNALYGFHREPSKNIIEFRSGDIASFWLLHTANAAFATLAHLHQHAALHPERLFQELLRLAGQLMT
FSKGYTLADLPVYRHDDPGPSFARLDLMLRELLDTVISTRYFAITLDEVRPSFHLGRLDSGKIDDKTEFY
LAVSADMPSVELVDAVPARFKVGAPDDVDKLVLSAMPGVRLSYTPQVPPAIPVRPGACYFALDSRSPLYE
RMLQAQSAMIYAPTGINDLKFELIAVTS
 
Nucleotide Sequence: 1347 bp     [Download]
>gi|116688024|ref|NC_008542.1|:c516911-515565 Burkholderia cenocepacia HI2424 chromosome 1, complete sequence
ATGAGTTATTCGGCCAAGGTGCTGTGGGGGGAAGGGCTGTTCCTCCGGCCTCAACACTTTCAGCGACAGG
ACGCGTACCACGAGGCGCGCCTGTTCGAGTCCATCCAGGCGATCCAGCCGTACAACTGGGGCGTGCGCTC
GGTGCGCATCGACCGCGACGCGCTCGGCAGCAACGTGCTGCGGGTCGCCGAGCTCGCGCTCGTGTTCCCG
GACGGCGCGCTGTATGCCGCGCCGCAGGCAGACGATCTGCCGCCGCCGATCGCGCTGGATACGTTGCCCG
ACGGCATCAACGAATTCGTGTTCTATCTCGCGCTGCACCCGCTGCGCGAGAACGGCACCAACTACAGCGA
CGATCCGGCCGCCGGCTTCATGACGCGGTTCGTCAGCGAGCAGACGAGCGTTGCCGACAACTTCACCGAC
GCCGCCGAAGCCGACATCACGTTCCTGAAGACGCAGGTCAAGCTGATCGCGCACAGCGAGCCGCGCGACC
AGCTGCTGTCGGTGCCGCTCGTGCGTGTGCGCCGCACCGCGACGTCCGGCTTCGAGATCGACGACAGCTT
CGTGCCGCCGTGCCTCGCGATCGAAGCGTCGCCGATCCTGCACCAGCGGCTGCGCCAGCTGGTCGACGCA
CTGCAGGCCAAGGTGAACGCGCTGTACGGCTTCCACCGCGAACCGTCCAAGAACATCATCGAATTCCGTT
CGGGCGACATCGCGTCGTTCTGGCTGCTGCATACGGCGAACGCCGCATTCGCGACGCTCGCGCACCTGCA
CCAGCACGCGGCGCTGCATCCGGAGCGGCTGTTCCAGGAACTGCTGCGCCTCGCGGGCCAGCTGATGACG
TTCTCGAAGGGCTATACGCTCGCCGACCTGCCCGTGTACCGTCACGACGACCCGGGCCCGAGCTTCGCGC
GCCTCGACCTGATGCTGCGCGAACTGCTCGACACCGTGATCTCGACGCGCTATTTCGCGATCACGCTCGA
CGAGGTGCGCCCGTCGTTCCACCTTGGCCGCCTCGATTCCGGCAAGATCGACGACAAGACCGAGTTCTAC
CTCGCGGTATCCGCGGACATGCCGAGCGTCGAGCTCGTCGATGCGGTGCCGGCCCGCTTCAAGGTCGGCG
CGCCTGACGACGTCGACAAGCTCGTGCTGTCGGCGATGCCCGGCGTGCGGCTGTCGTACACGCCGCAGGT
GCCGCCCGCGATTCCGGTGCGCCCCGGCGCGTGCTACTTCGCGCTCGATTCACGCAGCCCGCTGTACGAG
CGCATGCTGCAGGCCCAGTCCGCGATGATCTACGCGCCGACTGGCATCAATGACCTGAAATTCGAACTGA
TCGCGGTCACATCATGA
 Primer design