SecReT6
Protein ID: 116688489
SecReT6 ID154
T6SS typei4b
Gene symbol-
Locus tagBcen2424_0465
StrainBurkholderia cenocepacia HI2424
Repliconchromosome I [GenBank: NC_008542] [Browse all T6SS(s) in this replicon]
Location [Strand]517014..517625 [-]
Producthypothetical protein
NoteTssJ
UniProt IDA0K3Z2
KEGG IDbch:Bcen2424_0465
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 7.80E-38, Aligned region: 15..175
Protein Sequence: 203 a.a.     [Download]
>gi|116688489|ref|YP_834112.1| hypothetical protein Bcen2424_0465 [Burkholderia cenocepacia HI2424]
MRSSMIRYALPLVACALLAGCAAAPLLGSAASAVMSAAGIGKPEVPDAQKPPRNIGLTLAAAPNLNAATD
HKPLALVVRLYALKDPTSFQQAPFDAFTDPTKEKAALGADLLNVREITLIPGQRYTATEKVSREAQAFGI
VALFRDPALQRWKLTFDPAKSEKSGIIIGLHNCAMTVTDGTVIAPQQGAPSQPLNLLSSVSCG
 
Nucleotide Sequence: 612 bp     [Download]
>gi|116688024|ref|NC_008542.1|:c517625-517014 Burkholderia cenocepacia HI2424 chromosome 1, complete sequence
ATGAGATCGTCCATGATTCGCTACGCGCTGCCGCTGGTTGCCTGCGCCCTTTTGGCCGGATGCGCGGCCG
CCCCGCTGCTCGGCTCGGCCGCGAGCGCCGTGATGTCCGCGGCCGGCATCGGCAAGCCCGAGGTGCCCGA
CGCGCAGAAGCCGCCGCGCAACATCGGGCTCACGCTGGCCGCCGCGCCGAACCTGAATGCCGCGACCGAC
CACAAGCCGCTCGCGCTCGTCGTCCGGCTTTATGCGCTGAAGGACCCGACCTCGTTCCAGCAAGCGCCGT
TCGACGCCTTTACCGATCCGACCAAGGAAAAAGCTGCACTCGGCGCCGATCTGCTGAATGTGCGCGAAAT
CACGCTGATTCCGGGCCAGCGCTATACGGCAACCGAGAAGGTATCGCGCGAGGCCCAGGCATTCGGCATC
GTCGCGCTGTTCCGCGATCCCGCACTGCAACGATGGAAACTGACATTCGATCCGGCGAAATCGGAGAAAT
CCGGCATAATCATCGGCCTGCATAATTGCGCGATGACGGTCACCGACGGCACGGTCATCGCACCGCAACA
AGGTGCGCCTTCGCAACCGCTGAATTTGCTGTCTTCGGTCTCTTGCGGTTAA
 Primer design