SecReT6
Protein ID: 116688491
SecReT6 ID154
T6SS typei4b
Gene symbol-
Locus tagBcen2424_0467
StrainBurkholderia cenocepacia HI2424
Repliconchromosome I [GenBank: NC_008542] [Browse all T6SS(s) in this replicon]
Location [Strand]518680..519195 [+]
Producthypothetical protein
NoteTssB
UniProt IDA0K3Z4
KEGG IDbch:Bcen2424_0467
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 2.60E-59, Aligned region: 11..163
Protein Sequence: 171 a.a.     [Download]
>gi|116688491|ref|YP_834114.1| hypothetical protein Bcen2424_0467 [Burkholderia cenocepacia HI2424]
MAKKESIQKSLQKIRPPRVQLTYEVEKGDAIEVKELPFVVGVVGDLAGQSEIEQPKLRDRKFVNIDRDNF
DDVMKAIEPRAAFQVENRLSPEGGKFAVDLKFRSLSDFSPDEVVEQVEPLRRLLEARSKLADLRNKLAGN
DKLEDLLSEVLKNTQQLQELAKGTGGDKDGE
 
Nucleotide Sequence: 516 bp     [Download]
>gi|116688024|ref|NC_008542.1|:518680-519195 Burkholderia cenocepacia HI2424 chromosome 1, complete sequence
ATGGCCAAGAAAGAAAGCATTCAGAAAAGCTTGCAGAAAATACGGCCGCCGCGCGTCCAGCTGACCTACG
AGGTCGAGAAGGGCGATGCGATCGAGGTGAAGGAGCTGCCGTTCGTCGTCGGGGTCGTTGGCGATCTGGC
GGGCCAGTCCGAAATCGAGCAGCCGAAGCTGCGCGATCGTAAATTCGTCAACATCGACCGCGATAATTTC
GACGACGTGATGAAGGCGATCGAGCCGCGTGCCGCGTTCCAGGTGGAAAATCGCCTGAGCCCGGAAGGCG
GCAAGTTCGCGGTCGACCTGAAGTTCCGCTCGCTGTCGGATTTCAGCCCGGACGAAGTCGTCGAACAGGT
CGAGCCGCTGCGCCGCCTGCTCGAGGCGCGCTCGAAGCTCGCCGACCTGCGCAACAAGCTCGCCGGCAAC
GACAAGCTCGAGGATCTGCTGTCCGAGGTGCTGAAGAACACGCAGCAGCTGCAGGAGCTCGCGAAGGGCA
CCGGCGGCGACAAAGACGGCGAATGA
 Primer design