SecReT6
Protein ID: 116688492
SecReT6 ID154
T6SS typei4b
Gene symbol-
Locus tagBcen2424_0468
StrainBurkholderia cenocepacia HI2424
Repliconchromosome I [GenBank: NC_008542] [Browse all T6SS(s) in this replicon]
Location [Strand]519211..520701 [+]
Producthypothetical protein
NoteTssC
UniProt IDA0K3Z5
KEGG IDbch:Bcen2424_0468
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 7.20E-191, Aligned region: 67..491
Protein Sequence: 496 a.a.     [Download]
>gi|116688492|ref|YP_834115.1| hypothetical protein Bcen2424_0468 [Burkholderia cenocepacia HI2424]
MNQQTAAAQASGAEYAAGTSLLDDIVEKSKVAKSDSEHARAKDLIGELVHQVLDGTVIVSDNLSATIDAR
VAELDRLISTQLSAVMHAPEFQRLESTWRGMDYLVKESNTGQTIKIKALHAPKRDLVRDFKGASEFDQSA
LFKKVYEEEFGTFGGSPFGALIGDYEISRQPEDMYFIEQMSHVAAAAHAPFIASASPELLGLESFSDLGK
PRDLGKVFDTVEYAKWKSFRDAEDSRYVGLTLPRFLGRLPFNPKDGQTAENFNFVEDVDGTDHDKYLWCN
AAWAFAARLTAAFDDFGWCAAIRGVEGGGLVEDLPTHTFKTDDGEVALKCPTEIAITDRREKELSDLGFI
PLVHCKNSDYAAFFAAQSVQKPKKYSTDSANANAVLSAQLQYIFSVSRVAHYLKAMMRDKIGSFASAQNV
ETFLNRWISQYVLLDDNASQEQKAQFPLREASIQVSEIPGKPGSYRSVAFLRPHFQLDELSISLRLVADL
PKPANS
 
Nucleotide Sequence: 1491 bp     [Download]
>gi|116688024|ref|NC_008542.1|:519211-520701 Burkholderia cenocepacia HI2424 chromosome 1, complete sequence
ATGAACCAGCAAACGGCTGCGGCCCAAGCGAGCGGCGCGGAATACGCCGCCGGGACTTCGCTGCTCGACG
ACATCGTCGAGAAGAGCAAGGTCGCGAAATCCGATTCCGAGCATGCGCGTGCGAAGGACCTGATCGGCGA
ACTCGTGCATCAGGTGCTCGACGGCACGGTGATCGTGTCGGACAACCTGTCGGCCACGATCGACGCGCGC
GTCGCGGAGCTCGACCGCCTGATTTCCACGCAGCTTTCCGCCGTGATGCACGCGCCGGAATTCCAGCGCC
TCGAAAGCACGTGGCGCGGGATGGATTATCTGGTCAAGGAAAGCAACACGGGCCAGACGATCAAGATCAA
GGCGCTGCACGCGCCGAAGCGCGATCTCGTGCGCGATTTCAAGGGCGCGAGCGAGTTCGACCAGAGCGCG
CTGTTCAAGAAGGTCTACGAAGAGGAATTCGGCACGTTCGGCGGCTCGCCGTTCGGTGCGCTGATCGGCG
ATTACGAGATCTCGCGCCAGCCGGAAGACATGTACTTCATCGAGCAGATGTCGCATGTCGCGGCGGCCGC
GCATGCGCCGTTCATCGCGTCGGCGTCGCCGGAGCTGCTCGGCCTCGAGTCGTTCTCCGACCTCGGCAAG
CCGCGCGACCTCGGCAAGGTGTTCGACACCGTCGAATACGCGAAGTGGAAGTCGTTCCGAGACGCCGAGG
ATTCGCGCTACGTCGGCCTGACGCTGCCGCGCTTTCTCGGCCGCCTGCCGTTCAATCCGAAGGACGGCCA
GACCGCGGAGAACTTCAACTTCGTCGAGGACGTCGACGGCACCGATCACGACAAGTACCTGTGGTGCAAC
GCGGCATGGGCCTTCGCGGCCCGCCTGACGGCCGCGTTCGACGACTTCGGCTGGTGCGCGGCGATCCGCG
GCGTCGAAGGCGGCGGCCTCGTCGAGGATCTGCCGACCCACACGTTCAAGACCGACGACGGTGAAGTCGC
GCTGAAGTGCCCGACCGAAATCGCGATCACCGATCGCCGCGAGAAGGAGCTGAGCGATCTCGGCTTCATC
CCGCTCGTCCATTGCAAGAACTCAGATTACGCCGCGTTCTTCGCTGCGCAGTCGGTGCAGAAGCCCAAGA
AATACAGCACCGACAGCGCGAACGCGAATGCCGTCCTGTCCGCCCAGCTTCAGTACATCTTCTCGGTATC
GCGCGTCGCGCACTACCTGAAGGCGATGATGCGGGACAAGATCGGCAGCTTCGCATCGGCGCAGAACGTG
GAGACTTTCCTCAACCGGTGGATTTCGCAGTACGTCCTGCTCGACGACAACGCCTCGCAGGAACAGAAAG
CGCAATTTCCGCTGCGCGAGGCATCCATACAAGTGTCGGAGATTCCGGGCAAGCCGGGCTCGTATCGTTC
GGTCGCGTTCCTGCGCCCGCACTTTCAGCTCGACGAACTCTCGATTTCTCTGCGACTTGTCGCTGATCTG
CCCAAACCGGCAAATTCATAA
 Primer design