SecReT6
Protein ID: 116688493
SecReT6 ID154
T6SS typei4b
Gene symbol-
Locus tagBcen2424_0469
StrainBurkholderia cenocepacia HI2424
Repliconchromosome I [GenBank: NC_008542] [Browse all T6SS(s) in this replicon]
Location [Strand]520772..521275 [+]
Producthypothetical protein
NoteTssD
UniProt IDA0K3Z6
KEGG IDbch:Bcen2424_0469
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 6.70E-43, Aligned region: 7..139
Protein Sequence: 167 a.a.     [Download]
>gi|116688493|ref|YP_834116.1| hypothetical protein Bcen2424_0469 [Burkholderia cenocepacia HI2424]
MLHMHLQFGSPAVKGESADKDHQGWIELKSWDHSIVQPRSATASTAGGHTMTRCEHGDMIFTKEIDSSSP
LLYQHASGGTTFDEVTVHFSRADGEGKRVQYLEVKLKYVIISSIAPSVREEGLPLETFSLKYAAVQWKQT
QQKIGGNQGGNTQGAWSLTKNDKTYAV
 
Nucleotide Sequence: 504 bp     [Download]
>gi|116688024|ref|NC_008542.1|:520772-521275 Burkholderia cenocepacia HI2424 chromosome 1, complete sequence
ATGTTACATATGCACTTGCAGTTTGGTAGTCCCGCGGTGAAGGGCGAGTCCGCGGATAAAGACCACCAAG
GCTGGATCGAACTGAAATCGTGGGATCACTCGATCGTTCAGCCGCGTTCGGCAACCGCATCGACCGCTGG
CGGTCACACGATGACGCGTTGCGAGCACGGCGACATGATCTTCACGAAGGAAATCGATTCGTCGAGCCCG
CTGCTGTATCAGCACGCTTCGGGCGGTACCACGTTCGACGAAGTGACGGTCCATTTCTCGCGCGCGGACG
GTGAAGGCAAGCGCGTGCAGTATCTGGAAGTCAAGCTCAAGTACGTGATCATCTCGAGCATCGCGCCGAG
CGTTCGCGAGGAAGGTCTGCCGCTCGAGACGTTCTCGCTGAAGTACGCAGCCGTGCAGTGGAAGCAAACC
CAGCAGAAGATCGGCGGCAACCAGGGCGGCAACACGCAAGGCGCCTGGAGTCTGACGAAGAACGACAAGA
CCTACGCGGTCTAA
 Primer design