SecReT6
Protein ID: 116688494
SecReT6 ID154
T6SS typei4b
Gene symbol-
Locus tagBcen2424_0470
StrainBurkholderia cenocepacia HI2424
Repliconchromosome I [GenBank: NC_008542] [Browse all T6SS(s) in this replicon]
Location [Strand]521338..521823 [+]
Producthypothetical protein
NoteTssE
UniProt IDA0K3Z7
KEGG IDbch:Bcen2424_0470
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 1.70E-22, Aligned region: 29..137
Protein Sequence: 161 a.a.     [Download]
>gi|116688494|ref|YP_834117.1| hypothetical protein Bcen2424_0470 [Burkholderia cenocepacia HI2424]
MKRFEPSFLDKLFDDEPHLPASAAMRQLSLDELKNTVARDVEAILNTRIAHTENELAALPECQKSVLTYG
LNDFAGLSLASHYDRAFICKSIQQAIARHEPRLQQVQVTFELNEQATNALYFAIQALLVVHPAEEPVSFD
AMLQPSTLQYSVTRARAARMQ
 
Nucleotide Sequence: 486 bp     [Download]
>gi|116688024|ref|NC_008542.1|:521338-521823 Burkholderia cenocepacia HI2424 chromosome 1, complete sequence
ATGAAACGATTCGAACCCAGTTTTCTCGACAAGCTGTTCGACGACGAACCGCATCTGCCGGCCTCGGCTG
CGATGCGGCAATTGTCGCTGGACGAGCTCAAGAACACGGTCGCCCGCGACGTCGAGGCGATCCTCAACAC
CCGTATCGCGCACACCGAGAACGAGCTGGCGGCGCTGCCGGAATGCCAGAAGTCGGTGCTGACCTACGGG
CTGAACGATTTCGCGGGGCTGAGCCTCGCGAGCCATTACGACCGCGCATTCATCTGCAAGTCGATCCAGC
AGGCCATCGCGCGCCACGAGCCGCGCCTGCAGCAGGTGCAGGTGACGTTCGAGCTGAACGAGCAGGCCAC
CAACGCGCTGTACTTCGCGATCCAGGCGCTGCTCGTCGTGCACCCGGCCGAGGAGCCGGTGAGTTTCGAC
GCGATGCTGCAACCGTCGACGCTGCAGTATTCGGTCACGCGCGCACGCGCGGCACGCATGCAGTAA
 Primer design