SecReT6
Protein ID: 116688495
SecReT6 ID154
T6SS typei4b
Gene symbol-
Locus tagBcen2424_0471
StrainBurkholderia cenocepacia HI2424
Repliconchromosome I [GenBank: NC_008542] [Browse all T6SS(s) in this replicon]
Location [Strand]521900..523735 [+]
Producthypothetical protein
NoteTssF
UniProt IDA0K3Z8
KEGG IDbch:Bcen2424_0471
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 4.20E-216, Aligned region: 4..610
Protein Sequence: 611 a.a.     [Download]
>gi|116688495|ref|YP_834118.1| hypothetical protein Bcen2424_0471 [Burkholderia cenocepacia HI2424]
MEELLPYYERELSFLRRYSRDFAERYPKIAARLALSGEHCEDPHVERMIESFALLGARINKKLDDDYPEF
TEALLEVLYPHYLRPFPSCSIAQFTPASPGQQTEPVVIDRGTELKSRPIRGVQCRFRTAYDVTLAPIRIS
EARYTPVALAPSATVLPSNATGVISITFESLAAQLDLGALKLSTLRAHLHGEQSFVAALTDCLFVNVLGA
YVEPERNGRWTALRKLPIAQAGFAEDDALIDYPAKSHPAYRLLTEYFAFPDKFDFVDFDLAAIARASGRC
QRATLHLVLQDVRSDSHIARLLELLTASHFRLFCTPIVNLFRQHGEPIRITHRAVSYPVIAEARRAFAYE
VYSIDSVKLVRQQAHEESVIEFRPFYSLHHGESARIGHYWFARRNDWVAQKSPGYETEISIVDIDFEPTS
PQTDTLSLDLTCTNRDLPSMLAFGLEGGDLFQEGGAQTSGISLLRRPTQSVRFERGRAAHWRLVSHLALN
HVSLVAHGLAPLKEMLTLYDLRRTAVSMRQIDGLAGVEQRGAVQWLPGKPFATFVRGIEIRLTIDEEHFV
GASLASFVRVLDSFFGLYVHLNSFVQLVVVSKRTGEEIIRCKPRTGESILA
 
Nucleotide Sequence: 1836 bp     [Download]
>gi|116688024|ref|NC_008542.1|:521900-523735 Burkholderia cenocepacia HI2424 chromosome 1, complete sequence
ATGGAAGAATTGCTGCCGTATTACGAACGCGAATTATCGTTTTTGCGGCGCTATTCGCGAGATTTCGCCG
AACGCTATCCGAAGATCGCCGCGCGTCTCGCGCTGTCCGGCGAGCATTGCGAGGATCCGCACGTCGAGCG
GATGATCGAGTCGTTCGCGCTGCTCGGCGCGCGTATCAACAAGAAGCTCGACGACGATTACCCGGAATTC
ACCGAAGCGCTGCTGGAAGTGCTGTATCCGCACTACCTGCGGCCGTTCCCGTCGTGCTCGATCGCGCAGT
TCACGCCGGCGTCGCCCGGTCAGCAGACCGAACCGGTCGTGATCGATCGCGGCACCGAGCTGAAAAGCCG
CCCGATCCGCGGCGTGCAATGCCGGTTCCGTACCGCCTACGACGTGACGCTTGCGCCGATCCGCATCTCG
GAGGCGCGCTATACGCCGGTCGCGCTCGCGCCGAGCGCGACGGTGCTGCCGTCGAACGCGACGGGCGTGA
TCTCGATCACGTTCGAATCGCTCGCCGCGCAGCTCGATCTCGGCGCGCTGAAGCTGTCGACGCTGCGCGC
GCACCTGCACGGCGAGCAGTCGTTCGTCGCCGCGCTGACCGACTGCCTGTTCGTCAACGTGCTCGGCGCG
TACGTCGAGCCCGAACGCAACGGCCGCTGGACCGCGCTGCGCAAGCTGCCGATCGCGCAGGCCGGTTTCG
CCGAGGACGACGCGCTGATCGACTATCCGGCGAAATCGCATCCCGCGTACCGGCTGCTCACCGAATACTT
CGCGTTCCCCGACAAGTTCGATTTCGTCGACTTCGACCTCGCGGCGATCGCACGCGCGTCGGGCCGCTGC
CAGCGCGCGACGCTGCATCTGGTGCTGCAGGACGTGCGCAGCGATTCGCATATCGCGCGCCTGCTCGAGC
TGCTGACGGCGAGCCATTTCCGGCTGTTCTGCACGCCGATCGTCAACCTGTTCCGCCAGCACGGGGAGCC
GATCCGCATCACGCACCGCGCGGTGTCGTATCCGGTGATTGCCGAGGCGCGGCGTGCGTTCGCGTACGAG
GTGTACTCGATCGACTCGGTGAAGCTCGTCCGGCAGCAGGCGCACGAGGAATCGGTGATCGAGTTCCGGC
CGTTCTATTCGCTGCATCACGGCGAATCGGCGCGCATCGGCCATTACTGGTTCGCGCGCCGCAACGACTG
GGTCGCGCAGAAGAGCCCCGGCTATGAAACCGAGATCTCGATCGTCGACATCGACTTCGAGCCGACGTCG
CCGCAGACCGACACGCTGAGCCTCGACCTCACCTGCACGAACCGCGACCTGCCTTCGATGCTGGCGTTCG
GCCTCGAAGGCGGCGACCTGTTCCAGGAAGGCGGGGCGCAGACGAGCGGCATCTCGCTGCTGCGCCGCCC
GACGCAGAGCGTGCGCTTCGAGCGCGGCCGTGCCGCGCACTGGCGGCTCGTGTCGCATCTCGCGCTCAAC
CACGTGTCGCTCGTTGCGCACGGCCTCGCGCCGCTGAAGGAAATGCTGACGCTGTACGACCTGCGGCGCA
CGGCCGTGTCGATGCGCCAGATCGACGGGCTGGCCGGCGTCGAGCAGCGCGGGGCGGTGCAGTGGCTGCC
CGGCAAGCCGTTCGCGACCTTCGTGCGCGGCATCGAGATCCGGCTGACGATCGACGAAGAGCACTTCGTC
GGCGCGAGCCTTGCGTCGTTCGTGCGCGTGCTCGACAGCTTCTTCGGGCTGTACGTCCACCTCAACAGTT
TCGTTCAATTGGTCGTCGTGTCGAAGCGCACCGGCGAGGAGATCATCCGATGCAAGCCCCGAACCGGCGA
ATCGATCCTGGCGTAG
 Primer design