SecReT6
Protein ID: 116688496
SecReT6 ID154
T6SS typei4b
Gene symbol-
Locus tagBcen2424_0472
StrainBurkholderia cenocepacia HI2424
Repliconchromosome I [GenBank: NC_008542] [Browse all T6SS(s) in this replicon]
Location [Strand]523699..524799 [+]
Producthypothetical protein
NoteTssG
UniProt IDA0K3Z9
KEGG IDbch:Bcen2424_0472
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 9.20E-95, Aligned region: 18..347
Protein Sequence: 366 a.a.     [Download]
>gi|116688496|ref|YP_834119.1| hypothetical protein Bcen2424_0472 [Burkholderia cenocepacia HI2424]
MQAPNRRIDPGVVDALLDEPHRFEFFQAVRVLEGLFARQASDAPGAWRQGDVVAQHIAFRNTLSLGFPPS
EIEGARSFDDDGAPLNSDDERGTALAAGELGRVELTPAFFGLLGGQGALPLHYTEQIVAREHLRRDHAAR
AFFDVFSNRATALFYAAWKKYRLPFHYELDRDERYLPLLLAIAGVPSDEVRDSLAAGPGGVLDEAVAGYA
LAARHRPMSAAYLQRTLSDYFRVPVKIDQFVGKWYDVPPDQLSVLGEVNAVLGATALVGERVWQRDMRAR
IVVGPLSKRDYEAFLPGGAHAVALERMLTLLAGVTLEYEVKLVLKRTEVGASVLGAGSRLGWDAFLCTRD
ALEDRSDARYELHVIH
 
Nucleotide Sequence: 1101 bp     [Download]
>gi|116688024|ref|NC_008542.1|:523699-524799 Burkholderia cenocepacia HI2424 chromosome 1, complete sequence
ATGCAAGCCCCGAACCGGCGAATCGATCCTGGCGTAGTCGACGCGCTGCTCGACGAGCCGCACCGCTTCG
AGTTCTTCCAGGCGGTGCGGGTGCTCGAAGGGCTGTTCGCGCGGCAGGCGTCGGATGCGCCCGGCGCGTG
GCGGCAGGGCGACGTGGTCGCGCAGCACATCGCATTCCGCAACACGCTGTCGCTCGGCTTCCCGCCGAGC
GAGATCGAAGGCGCGCGTTCGTTCGACGACGACGGCGCGCCGCTGAACTCGGACGACGAGCGCGGCACCG
CGCTGGCCGCCGGTGAGCTCGGCCGCGTCGAGCTGACGCCCGCGTTCTTCGGGCTGCTCGGCGGGCAGGG
CGCGCTGCCGCTGCACTACACCGAGCAGATCGTCGCGCGCGAGCACCTGCGGCGCGACCATGCGGCGCGT
GCGTTCTTCGACGTGTTCTCGAACCGCGCGACCGCGCTGTTCTATGCGGCGTGGAAGAAATACCGGCTGC
CGTTCCATTACGAGCTCGACCGCGACGAGCGCTACCTGCCGCTGTTGCTCGCGATCGCGGGCGTGCCGAG
CGACGAGGTGCGCGACAGCCTCGCGGCCGGCCCGGGCGGCGTGCTCGACGAAGCCGTGGCCGGCTACGCG
CTCGCGGCGCGGCACCGGCCGATGTCGGCCGCCTACCTGCAACGCACGCTGTCTGATTACTTCCGCGTGC
CGGTGAAGATCGACCAGTTCGTCGGCAAGTGGTACGACGTGCCGCCCGATCAGCTGAGCGTGCTCGGCGA
AGTCAACGCGGTGCTCGGCGCGACGGCGCTCGTCGGCGAGCGCGTGTGGCAGCGCGACATGCGCGCGCGG
ATCGTCGTCGGCCCGCTGTCCAAGCGCGACTACGAGGCGTTCCTGCCCGGCGGCGCGCACGCCGTCGCGC
TCGAGCGGATGCTGACGCTGCTCGCCGGCGTCACGCTCGAGTACGAGGTGAAGCTCGTGCTCAAGCGCAC
CGAGGTCGGCGCGAGCGTGCTCGGCGCGGGCTCGCGGCTCGGCTGGGATGCGTTCCTGTGCACGCGCGAT
GCGCTGGAGGATCGCTCGGACGCCCGCTACGAACTGCACGTGATTCACTGA
 Primer design