SecReT6
Protein ID: 116688497
SecReT6 ID154
T6SS typei4b
Gene symbol-
Locus tagBcen2424_0473
StrainBurkholderia cenocepacia HI2424
Repliconchromosome I [GenBank: NC_008542] [Browse all T6SS(s) in this replicon]
Location [Strand]524841..527510 [+]
ProductATPase
NoteTssH
UniProt IDA0K400
KEGG IDbch:Bcen2424_0473
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 2.80E-44, Aligned region: 231..328
AAA_2 [PF07724], Evalue: 2.80E-44, Aligned region: 619..787
AAA [PF00004], Evalue: 1.60E-19, Aligned region: 129..156
AAA [PF00004], Evalue: 1.60E-19, Aligned region: 232..345
AAA [PF00004], Evalue: 1.60E-19, Aligned region: 477..513
AAA [PF00004], Evalue: 1.60E-19, Aligned region: 624..741
AAA_5 [PF07728], Evalue: 1.70E-13, Aligned region: 232..252
AAA_5 [PF07728], Evalue: 1.70E-13, Aligned region: 306..362
AAA_5 [PF07728], Evalue: 1.70E-13, Aligned region: 623..743
ClpB_D2-small [PF10431], Evalue: 6.80E-12, Aligned region: 794..867
AAA_16 [PF13191], Evalue: 3.10E-11, Aligned region: 43..75
AAA_16 [PF13191], Evalue: 3.10E-11, Aligned region: 209..256
AAA_16 [PF13191], Evalue: 3.10E-11, Aligned region: 276..310
AAA_16 [PF13191], Evalue: 3.10E-11, Aligned region: 474..539
AAA_16 [PF13191], Evalue: 3.10E-11, Aligned region: 596..659
AAA_16 [PF13191], Evalue: 3.10E-11, Aligned region: 690..712
AAA_16 [PF13191], Evalue: 3.10E-11, Aligned region: 789..829
Clp_N [PF02861], Evalue: 1.20E-07, Aligned region: 23..74
Clp_N [PF02861], Evalue: 1.20E-07, Aligned region: 113..131
AAA_22 [PF13401], Evalue: 1.50E-06, Aligned region: 232..318
AAA_22 [PF13401], Evalue: 1.50E-06, Aligned region: 620..643
AAA_22 [PF13401], Evalue: 1.50E-06, Aligned region: 685..717
Sigma54_activat [PF00158], Evalue: 2.00E-06, Aligned region: 214..248
Sigma54_activat [PF00158], Evalue: 2.00E-06, Aligned region: 600..740
AAA_17 [PF13207], Evalue: 2.80E-05, Aligned region: 233..301
AAA_17 [PF13207], Evalue: 2.80E-05, Aligned region: 623..659
IstB_IS21 [PF01695], Evalue: 0.00015, Aligned region: 216..253
IstB_IS21 [PF01695], Evalue: 0.00015, Aligned region: 623..641
IstB_IS21 [PF01695], Evalue: 0.00015, Aligned region: 798..834
Arch_ATPase [PF01637], Evalue: 0.00027, Aligned region: 211..246
Arch_ATPase [PF01637], Evalue: 0.00027, Aligned region: 284..339
Arch_ATPase [PF01637], Evalue: 0.00027, Aligned region: 621..660
Arch_ATPase [PF01637], Evalue: 0.00027, Aligned region: 694..718
AAA_19 [PF13245], Evalue: 0.0005, Aligned region: 230..258
AAA_19 [PF13245], Evalue: 0.0005, Aligned region: 620..645
AAA_29 [PF13555], Evalue: 0.00063, Aligned region: 224..248
AAA_29 [PF13555], Evalue: 0.00063, Aligned region: 619..648
AAA_14 [PF13173], Evalue: 0.0012, Aligned region: 233..366
AAA_14 [PF13173], Evalue: 0.0012, Aligned region: 486..528
AAA_14 [PF13173], Evalue: 0.0012, Aligned region: 622..704
SRP54 [PF00448], Evalue: 0.0013, Aligned region: 232..253
SRP54 [PF00448], Evalue: 0.0013, Aligned region: 622..655
Zeta_toxin [PF06414], Evalue: 0.0015, Aligned region: 231..252
Zeta_toxin [PF06414], Evalue: 0.0015, Aligned region: 613..663
NACHT [PF05729], Evalue: 0.0017, Aligned region: 232..259
NACHT [PF05729], Evalue: 0.0017, Aligned region: 381..460
NACHT [PF05729], Evalue: 0.0017, Aligned region: 624..644
AAA_30 [PF13604], Evalue: 0.0021, Aligned region: 217..309
AAA_30 [PF13604], Evalue: 0.0021, Aligned region: 619..647
MobB [PF03205], Evalue: 0.0027, Aligned region: 233..256
MobB [PF03205], Evalue: 0.0027, Aligned region: 622..655
AAA_18 [PF13238], Evalue: 0.0036, Aligned region: 234..252
AAA_18 [PF13238], Evalue: 0.0036, Aligned region: 473..537
AAA_18 [PF13238], Evalue: 0.0036, Aligned region: 625..650
ResIII [PF04851], Evalue: 0.0059, Aligned region: 219..252
ResIII [PF04851], Evalue: 0.0059, Aligned region: 296..314
ResIII [PF04851], Evalue: 0.0059, Aligned region: 488..512
ResIII [PF04851], Evalue: 0.0059, Aligned region: 595..644
RNA_helicase [PF00910], Evalue: 0.0077, Aligned region: 233..253
RNA_helicase [PF00910], Evalue: 0.0077, Aligned region: 624..645
DEAD [PF00270], Evalue: 0.0093, Aligned region: 218..392
DEAD [PF00270], Evalue: 0.0093, Aligned region: 624..649
Protein Sequence: 889 a.a.     [Download]
>gi|116688497|ref|YP_834120.1| ATPase [Burkholderia cenocepacia HI2424]
MSTPLKTLITKLNPLCRHATERAASACLARGHYEVDLEHLFLALLDEATGDLPLALRASRVDPHALHADL
ERELTRLKTGNTRTPVFSVHLIALFEQAWLIASLDSQLGRIRSGHLLLALLTAPDLAQFAQRMSSRFAEM
NVTDLKHKFDEIMAGSSEAEPRQADDDGSDVAPAADGFAPAAGPSKTPALDTYTTNLTQRARDGKIDPVI
GREAEIRQAIDILMRRRQNNPIMTGEAGVGKTAVVEGLALRIAADDVPPPLRGVALHVLDMGLLQAGASV
KGEFENRLKSVIDEVKKSAHPIILFIDEAHTIIGAGGQAGQNDAANLLKPALARGELRTIAATTWSEYKK
YFEKDAALARRFQVVKVEEPSEPLAAAMLRGMSGLMEKHFNVRILDDAITEAVRLSHRYISGRQLPDKAI
SVLDTACAKVALAHSATPAAIDDTKKRIERIDAEIASLEREAAGGAAHDERLGELRGARDTALEQLAKDE
ERYEAERVIVAEITELRDALDRARGPSEDGQPVDVQATREKLAERVAALHALQGGEPMVPLQVDGHVVAE
IVAAWTGIPLGRMVKDEIDTVLNLQPLLTARVIGQDHALEAIAQRVRTATANLEDPNKPRGVFMFVGPSG
VGKTETALALADILYGGERKMVTINMSEYQEAHSVSGLKGSPPGYVGYGEGGVLTEAVRRNPYSVVLLDE
VEKAHPDVLEMFFQVFDKGTMDDAEGREIDFRNTLIILTSNVGSAAVMQACLNKPAEELPDPDALAEALR
PQLYKTFKPAFLGRMKVVPYYPISDDVLAEIIELKLERIRRRIEANHKAAFEWDESLVDAVLARCTEVDS
GARNVDHILNGTLLPEIAGHVLGRIADGAAIARIAVRADEAGEFAYTVE
 
Nucleotide Sequence: 2670 bp     [Download]
>gi|116688024|ref|NC_008542.1|:524841-527510 Burkholderia cenocepacia HI2424 chromosome 1, complete sequence
ATGAGCACGCCTCTGAAGACCCTGATCACGAAACTGAACCCGCTGTGCCGCCACGCGACCGAGCGTGCGG
CGAGCGCGTGCCTGGCGCGCGGCCACTACGAGGTCGATCTGGAGCATCTGTTCCTCGCGTTGCTCGACGA
AGCGACGGGCGATCTGCCGCTCGCCTTGCGCGCGAGCCGCGTCGATCCGCATGCGCTGCACGCCGATCTC
GAACGCGAGCTCACGCGCCTGAAGACGGGCAACACGCGCACGCCGGTGTTCTCCGTGCATCTGATCGCGC
TGTTCGAGCAGGCGTGGCTGATCGCGTCGCTCGATTCGCAGCTCGGCCGCATCCGTTCCGGGCACCTGCT
GCTCGCGCTGCTGACCGCGCCGGATCTCGCGCAGTTCGCGCAACGGATGTCGTCGCGCTTCGCGGAAATG
AACGTGACGGACCTGAAGCACAAGTTCGACGAAATCATGGCCGGTTCGAGCGAAGCCGAGCCGCGCCAGG
CGGACGACGACGGCAGCGACGTCGCGCCGGCCGCCGACGGCTTTGCGCCCGCGGCTGGCCCGTCGAAGAC
GCCCGCGCTCGACACCTATACGACCAACCTCACGCAGCGCGCGCGCGACGGCAAGATCGACCCGGTGATC
GGCCGCGAAGCGGAGATCCGCCAGGCGATCGACATCCTGATGCGCCGCCGCCAGAACAACCCGATCATGA
CCGGCGAGGCCGGCGTCGGCAAAACGGCGGTCGTCGAAGGGCTCGCGCTGCGGATCGCGGCCGACGACGT
GCCGCCGCCGCTGCGCGGCGTCGCGCTGCACGTGCTCGACATGGGGCTGCTGCAGGCCGGCGCGAGCGTG
AAGGGCGAGTTCGAGAACCGGCTGAAGAGCGTGATCGACGAGGTGAAGAAGAGCGCGCACCCGATCATCC
TGTTCATCGACGAGGCGCACACGATCATCGGCGCGGGCGGCCAGGCCGGCCAGAACGATGCGGCGAACCT
GCTGAAGCCCGCACTCGCGCGCGGCGAGCTGCGCACGATCGCCGCGACGACGTGGAGCGAATACAAGAAG
TACTTCGAGAAGGATGCGGCGCTCGCGCGGCGTTTCCAGGTCGTGAAGGTCGAGGAGCCGAGCGAGCCGC
TGGCCGCCGCGATGCTGCGCGGGATGTCGGGCCTGATGGAGAAGCACTTCAACGTGCGGATTCTCGACGA
TGCGATCACGGAGGCCGTGCGCCTGTCGCACCGCTACATCAGCGGCCGCCAGCTGCCGGACAAGGCGATC
AGCGTGCTCGATACCGCCTGCGCGAAGGTCGCGCTCGCGCACAGCGCGACGCCGGCCGCGATCGACGATA
CGAAGAAGCGCATCGAGCGCATCGATGCGGAAATCGCGTCGCTGGAGCGCGAGGCGGCGGGCGGCGCGGC
GCACGACGAGCGGCTCGGCGAGCTGCGCGGCGCGCGCGACACGGCGCTCGAACAACTGGCGAAGGATGAG
GAACGCTACGAAGCCGAGCGCGTGATCGTCGCCGAGATCACCGAGCTGCGCGATGCGCTCGACCGCGCAC
GCGGCCCGTCGGAGGACGGCCAGCCGGTCGACGTGCAGGCCACTCGCGAGAAACTCGCCGAACGCGTCGC
GGCGCTGCACGCGCTGCAGGGCGGCGAGCCGATGGTGCCGCTGCAGGTCGACGGCCACGTCGTCGCCGAG
ATCGTCGCCGCGTGGACGGGCATTCCGCTCGGCCGGATGGTGAAGGACGAGATCGACACCGTGCTGAACC
TGCAGCCGCTGCTGACCGCACGCGTGATCGGCCAGGATCATGCGCTGGAGGCGATCGCCCAGCGTGTGCG
CACCGCGACCGCGAACCTCGAGGACCCGAACAAGCCGCGCGGCGTGTTCATGTTCGTCGGGCCGTCGGGC
GTCGGCAAGACCGAGACGGCGCTGGCGCTGGCCGACATCCTGTACGGCGGCGAGCGCAAGATGGTCACGA
TCAACATGAGCGAGTACCAGGAAGCGCACAGCGTGTCGGGCCTGAAGGGGTCGCCGCCGGGCTACGTCGG
TTACGGCGAAGGCGGCGTGCTGACCGAGGCCGTGCGTCGCAACCCGTATTCCGTCGTGCTGCTCGACGAG
GTCGAGAAGGCGCACCCGGACGTGCTCGAGATGTTCTTCCAGGTGTTCGACAAGGGCACGATGGACGATG
CGGAAGGGCGCGAGATCGACTTCCGCAACACGCTGATCATCCTGACGTCGAACGTCGGCTCGGCCGCGGT
AATGCAGGCCTGCCTGAACAAGCCGGCCGAGGAGCTGCCCGATCCGGACGCGCTTGCCGAGGCGCTGCGC
CCGCAGCTGTACAAGACCTTCAAGCCGGCGTTCCTCGGCCGGATGAAGGTCGTGCCGTACTACCCGATTT
CCGACGACGTGCTGGCCGAGATCATCGAGCTGAAGCTCGAACGCATCCGCCGCCGGATCGAGGCGAACCA
CAAGGCCGCGTTCGAGTGGGACGAGTCGCTCGTCGACGCGGTGCTCGCACGCTGCACCGAGGTCGACTCG
GGCGCCCGCAACGTCGACCACATCCTGAACGGCACGCTGCTGCCGGAGATCGCGGGCCACGTGCTCGGCC
GGATCGCCGACGGCGCGGCGATCGCGCGCATCGCGGTGCGCGCGGACGAGGCCGGCGAATTCGCGTACAC
CGTCGAATGA
 Primer design