SecReT6
Protein ID: 116688498
SecReT6 ID154
T6SS typei4b
Gene symbol-
Locus tagBcen2424_0474
StrainBurkholderia cenocepacia HI2424
Repliconchromosome I [GenBank: NC_008542] [Browse all T6SS(s) in this replicon]
Location [Strand]527554..528675 [+]
ProductImpA domain-containing protein
NoteTssA
UniProt IDA0K401
KEGG IDbch:Bcen2424_0474
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 6.60E-24, Aligned region: 55..116
Protein Sequence: 373 a.a.     [Download]
>gi|116688498|ref|YP_834121.1| ImpA domain-containing protein [Burkholderia cenocepacia HI2424]
MPINLPELLTPISDASPSGDDLLFSNEFDAIQDARRYDDPTLDQGEWVTEIKEADWGFVVDHAGELLRTR
TKDLRLAVWLTEALALEDGITGLTEGYALLEGLCRDFWDTFHPLPEDDDIEHRLGNVAWLSGRTAELLRA
VPLTDGASNAFSTLDWEVAQHVAQSIKRDPEHADDIARGKPSIDQIDASRRVTSIAFYTALLANLKAFEF
ALDAFEERLVERAGDSAPSFRQARDAFETVYRLAERFAREQGYTGSAPHAQAAPQAQPERVEPVFGQPIQ
TEETHVQQQTASRPPVTQMIAGIQNRAQAVDQLRAVARYFRQTEPHSPVAYLADKAAEWADMPLHKWLES
VVKDDGSLSHIRELLGVRPDEQA
 
Nucleotide Sequence: 1122 bp     [Download]
>gi|116688024|ref|NC_008542.1|:527554-528675 Burkholderia cenocepacia HI2424 chromosome 1, complete sequence
ATGCCGATCAATCTCCCCGAGCTGCTGACACCGATCAGCGATGCGTCGCCCAGCGGCGACGACCTGCTGT
TTTCGAACGAATTCGACGCGATCCAGGACGCGCGGCGCTACGACGACCCGACGCTCGACCAGGGCGAATG
GGTAACCGAGATCAAGGAGGCCGACTGGGGCTTCGTCGTCGACCATGCGGGCGAGCTGCTGCGCACCCGC
ACCAAGGACCTGCGGCTCGCCGTGTGGCTGACCGAGGCGCTCGCGCTCGAGGACGGCATCACCGGCCTCA
CCGAAGGCTATGCGCTGCTCGAAGGCCTGTGCCGCGACTTCTGGGACACCTTTCACCCGCTGCCCGAGGA
CGACGACATCGAGCACCGGCTCGGCAACGTCGCGTGGCTGTCCGGCCGCACGGCCGAGCTGCTGCGCGCG
GTGCCGCTGACGGACGGCGCATCGAATGCGTTCAGCACGCTCGATTGGGAAGTCGCGCAGCACGTCGCGC
AGTCGATCAAGCGCGACCCCGAACATGCCGACGACATCGCGCGCGGCAAGCCGTCGATCGACCAGATCGA
CGCGTCGCGGCGCGTGACGTCGATCGCGTTCTACACGGCGCTGCTGGCGAACTTGAAGGCGTTCGAATTC
GCGCTCGATGCGTTCGAGGAGCGGCTCGTCGAGCGCGCGGGCGATTCGGCGCCGAGCTTCCGGCAGGCGC
GCGACGCGTTCGAGACCGTGTACCGGCTCGCCGAGCGCTTTGCGCGCGAACAGGGCTATACGGGCAGCGC
GCCGCACGCGCAGGCGGCGCCGCAGGCCCAGCCCGAACGCGTCGAGCCGGTGTTCGGCCAGCCGATCCAG
ACCGAGGAGACTCACGTGCAGCAGCAGACCGCTTCGCGTCCGCCGGTGACGCAGATGATCGCCGGCATCC
AGAACCGCGCGCAGGCCGTCGACCAGTTGCGCGCGGTGGCGCGCTATTTCCGTCAGACCGAGCCGCACAG
CCCGGTCGCGTATCTTGCCGACAAGGCGGCCGAGTGGGCCGACATGCCGCTGCACAAGTGGCTCGAGAGC
GTCGTGAAGGACGACGGCTCGCTGTCGCACATTCGCGAGCTGCTGGGGGTGAGGCCCGACGAGCAGGCGT
GA
 Primer design