SecReT6
Protein ID: 116688499
SecReT6 ID154
T6SS typei4b
Gene symbol-
Locus tagBcen2424_0475
StrainBurkholderia cenocepacia HI2424
Repliconchromosome I [GenBank: NC_008542] [Browse all T6SS(s) in this replicon]
Location [Strand]528742..531303 [+]
ProductRhs element Vgr protein
NoteTssI
UniProt IDA0K402
KEGG IDbch:Bcen2424_0475
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 8.40E-68, Aligned region: 42..354
DUF2345 [PF10106], Evalue: 4.30E-60, Aligned region: 670..822
T6SS_Vgr [PF13296], Evalue: 2.00E-36, Aligned region: 525..631
T6SS_Vgr [PF13296], Evalue: 2.00E-36, Aligned region: 696..708
Phage_base_V [PF04717], Evalue: 1.70E-20, Aligned region: 425..515
Protein Sequence: 853 a.a.     [Download]
>gi|116688499|ref|YP_834122.1| Rhs element Vgr protein [Burkholderia cenocepacia HI2424]
MNVTELAQAIRGGLIQQDRLLKTDIPSLPNNALVPRRAVTRSELGRDFSVTLDLVSTASDVELKTLVAQP
ITLWIQQADRSYQPINGYIHTARRLGADGGLSSYQLRFASWMHFLKFRSDMRYWQDQPVDAILADVFDRH
PQARGQYRFALSKPLPSRSYCRQSETDWNFVHRLMEDEGLFGFWRHSEDGKAHTFVITDDLHTVDALSPN
TVRFDRSGSGAETAGFTQWTASRTLQSTLHTTRTFDYKSPSSAGNPNGTSLPTKSGQGELPDQAEIYEYT
GAYTYPAQDRGEHLSKIRLEEWESRAKRFFGVGGVRSIDAGRRFTLVDHPEHDRDAASDREFAAIGVTRY
IENNLPASDHEASFPHSLQDALAQVKAGHGKGGAFEVGHDDGSAGFYLVEVEAQRASMPYRSPFEHRKPA
MQLETAVVVGPKGEEVYTDALNRIKVMFVWDRQSEGRETASCWMRVVQSDTGGGYGAVHIPRVGEEVLIG
YIGGDCDRPIVMHRVYNGAAKPQWHSDGLLSGFRSKEYAGSGHNEMVLDDATGQNRARLFSSSGNSLLHL
GYLIEQNGNTRGAYLGSGFDLRTDAYGALRAGQGLYVTTHPKQANSQPLDVTEAKQQLGSAEGLIESMSQ
VSEMHQAESLGTGRDALKQFADATQNSVAGVASGGGRTAGGGTGNANAFKEPVMLFASPAGIGMASQQSV
HLASEQHTNIVSGQSTFVTSGKSLIAGIRDRISLFAQNAGMKLFAGKGKVEVQAHADNVELTAQKAVKMV
AATEAVDVAAKQEILLTSGGAYIRIKGGKIELHAPGKVDFKGAQHQFSGPTSMQYPLPAMPGGTCKQCVL
NAHSGRESMVEAD
 
Nucleotide Sequence: 2562 bp     [Download]
>gi|116688024|ref|NC_008542.1|:528742-531303 Burkholderia cenocepacia HI2424 chromosome 1, complete sequence
ATGAACGTGACCGAACTGGCCCAGGCGATTCGTGGCGGCCTGATCCAGCAGGATCGGCTGCTGAAGACGG
ACATCCCGTCGTTGCCGAACAATGCGCTCGTGCCGCGTCGCGCCGTAACCCGCTCGGAGCTCGGCCGTGA
TTTCAGCGTAACGCTCGATCTGGTGTCCACCGCGAGCGACGTCGAGCTCAAGACGCTGGTCGCGCAGCCG
ATCACGCTGTGGATTCAGCAGGCGGACAGGTCGTATCAGCCGATCAACGGCTATATCCACACGGCGCGGC
GGCTCGGTGCCGACGGCGGCCTGTCGAGTTACCAGCTGCGCTTCGCGTCGTGGATGCACTTCCTCAAGTT
CCGTAGCGACATGCGGTACTGGCAGGACCAGCCGGTCGACGCGATCCTCGCCGACGTGTTCGACAGGCAT
CCGCAGGCCAGGGGCCAATACCGGTTCGCGCTGTCGAAGCCGCTGCCGTCCCGTTCGTACTGCCGCCAGA
GCGAAACCGACTGGAACTTCGTGCATCGGCTGATGGAGGACGAAGGGCTGTTCGGCTTCTGGCGGCACAG
TGAAGACGGGAAGGCGCATACGTTCGTCATCACTGACGATCTGCATACCGTCGATGCGCTGTCGCCGAAT
ACCGTCAGGTTCGATCGCTCGGGCAGCGGCGCCGAAACCGCCGGTTTCACGCAATGGACCGCGTCGCGGA
CCTTGCAAAGTACGCTGCATACGACGCGCACGTTCGACTACAAGTCGCCGTCGTCGGCGGGCAATCCGAA
CGGCACGTCGCTGCCGACGAAAAGCGGGCAGGGCGAGCTGCCCGATCAGGCGGAAATTTACGAATACACC
GGCGCTTACACGTATCCGGCGCAGGACCGCGGCGAACACCTGTCGAAGATTCGCCTCGAGGAATGGGAGT
CGCGTGCGAAGCGTTTCTTCGGCGTGGGCGGCGTGCGTTCGATCGACGCCGGCCGGCGTTTCACCCTCGT
CGACCATCCGGAGCACGATCGCGATGCGGCGAGCGACCGCGAGTTCGCGGCCATCGGCGTCACGCGTTAC
ATCGAGAACAATCTGCCGGCCTCTGACCACGAAGCAAGTTTCCCGCATAGCCTGCAGGACGCGCTGGCGC
AGGTGAAGGCCGGGCACGGGAAAGGGGGCGCGTTCGAGGTCGGGCACGACGACGGCTCGGCCGGGTTCTA
TCTCGTCGAGGTCGAGGCGCAGCGCGCGAGCATGCCGTACCGCAGCCCGTTCGAGCACCGCAAGCCCGCG
ATGCAGCTCGAGACGGCCGTCGTGGTCGGTCCGAAGGGCGAGGAGGTCTATACCGACGCGCTGAACCGGA
TCAAGGTCATGTTCGTGTGGGACCGGCAGAGCGAAGGCCGCGAGACGGCATCGTGCTGGATGCGCGTCGT
GCAATCGGATACCGGCGGCGGTTACGGCGCGGTGCATATTCCGCGCGTCGGCGAGGAAGTGCTGATCGGC
TACATCGGCGGCGACTGCGATCGGCCGATCGTCATGCATCGTGTCTACAACGGGGCGGCCAAGCCGCAAT
GGCATAGCGACGGGCTCCTGTCGGGCTTCCGGTCGAAGGAGTATGCGGGGTCGGGGCACAACGAGATGGT
GCTCGACGACGCGACTGGGCAGAACCGCGCGCGCCTGTTCAGCAGCAGCGGGAATTCGCTGCTTCATCTC
GGCTATCTGATCGAGCAGAACGGCAACACCCGTGGTGCGTATCTCGGCTCGGGTTTCGATCTGCGCACGG
ATGCGTACGGCGCGCTGCGCGCGGGCCAAGGGCTGTACGTGACGACGCATCCGAAGCAGGCGAACAGTCA
GCCGCTCGATGTGACGGAGGCGAAGCAGCAGCTTGGCAGTGCAGAAGGGTTGATCGAGTCGATGTCGCAG
GTGAGCGAGATGCATCAGGCCGAGAGCCTCGGTACCGGTCGCGATGCGCTGAAGCAGTTCGCCGATGCGA
CGCAGAACAGCGTGGCGGGGGTGGCCTCGGGGGGCGGCAGGACGGCCGGCGGCGGAACGGGGAATGCCAA
TGCGTTCAAGGAACCCGTGATGCTGTTCGCGAGCCCGGCGGGGATCGGGATGGCGTCGCAGCAGTCGGTG
CATCTGGCGAGCGAGCAGCACACCAATATTGTCAGCGGGCAAAGCACGTTCGTGACCAGTGGGAAATCGC
TGATCGCCGGCATCCGGGATCGCATCAGCCTGTTCGCGCAGAACGCCGGGATGAAGCTGTTTGCCGGGAA
GGGCAAGGTCGAGGTCCAGGCGCACGCGGACAACGTCGAACTCACCGCGCAAAAGGCCGTGAAGATGGTA
GCGGCGACCGAGGCTGTCGACGTGGCTGCGAAGCAGGAGATATTGCTGACGTCGGGTGGCGCGTACATCC
GGATCAAGGGCGGCAAAATCGAGCTTCACGCACCCGGGAAAGTCGATTTCAAGGGGGCGCAGCACCAGTT
CAGCGGACCGACGAGCATGCAGTATCCATTGCCCGCGATGCCGGGCGGCACGTGCAAGCAATGCGTGCTG
AACGCGCACAGCGGTCGTGAGTCGATGGTCGAGGCGGATTGA
 Primer design