SecReT6
Protein ID: 116688504
SecReT6 ID154
T6SS typei4b
Gene symbol-
Locus tagBcen2424_0480
StrainBurkholderia cenocepacia HI2424
Repliconchromosome I [GenBank: NC_008542] [Browse all T6SS(s) in this replicon]
Location [Strand]536652..536909 [-]
ProductOmpA/MotB domain-containing protein
NoteTagL
UniProt IDA0K407, A0K407
KEGG IDbch:Bcen2424_0480
PDB IDNA
Domain hit(s) vs Pfam OmpA [PF00691], Evalue: 2.00E-20, Aligned region: 2..77
Protein Sequence: 85 a.a.     [Download]
>gi|116688504|ref|YP_834127.1| OmpA/MotB domain-containing protein [Burkholderia cenocepacia HI2424]
MAAALAKMQNRTVDIIGHTDNSGNRTSNIALSQARADAVKGYLITKSIPPQQMTTTGVGPDQPIAPNDTA
DGRARNRRIEFRVGQ
 
Nucleotide Sequence: 258 bp     [Download]
>gi|116688024|ref|NC_008542.1|:c536909-536652 Burkholderia cenocepacia HI2424 chromosome 1, complete sequence
ATGGCCGCCGCGCTGGCGAAGATGCAGAACCGCACGGTCGACATCATCGGTCACACCGACAACTCGGGGA
ATCGCACGTCGAACATCGCGCTGAGCCAGGCGCGCGCGGATGCGGTGAAGGGTTATCTGATCACGAAGAG
CATTCCGCCGCAGCAGATGACGACGACGGGGGTCGGGCCGGATCAGCCGATTGCGCCGAACGATACGGCG
GATGGCAGGGCGAGGAATCGGCGGATCGAGTTCCGGGTGGGGCAGTGA
 Primer design