SecReT6
Protein ID: 116688507
SecReT6 ID154
T6SS typei4b
Gene symbol-
Locus tagBcen2424_0483
StrainBurkholderia cenocepacia HI2424
Repliconchromosome I [GenBank: NC_008542] [Browse all T6SS(s) in this replicon]
Location [Strand]538876..539826 [-]
ProductOmpA/MotB domain-containing protein
NoteTagL
UniProt IDA0K410, A0K410
KEGG IDbch:Bcen2424_0483
PDB IDNA
Domain hit(s) vs Pfam OmpA [PF00691], Evalue: 2.20E-25, Aligned region: 150..183
OmpA [PF00691], Evalue: 2.20E-25, Aligned region: 214..308
BON [PF04972], Evalue: 4.80E-05, Aligned region: 87..125
BON [PF04972], Evalue: 4.80E-05, Aligned region: 160..179
Protein Sequence: 316 a.a.     [Download]
>gi|116688507|ref|YP_834130.1| OmpA/MotB domain-containing protein [Burkholderia cenocepacia HI2424]
MHRTIQVRRARLSAAVSPALAALFAAGLVASGAAFAQNTGATVTPVGNGTVATTALPQANPNAGGASGTV
VHGTAGTIAPPPANATPGQVVVGGKVPDEATKAAVLQKLRDTYGATNVVDQVEVGDVATPPNWSANVQKL
LGAQLKQISKGQLKINGTQIEMKGEVHNEAQRQQLASDMANTLNPTYTIKNGLRVSASEQGVLDQTLANR
TIEFETGSATLTPQGKLILDQMAAALAKMQNRTVDIIGHTDNSGNRTSNIALSQARADAVKGYLITKSIP
PQQMTTTGVGPDQPIAPNDMADGRARNRRIEFRVGQ
 
Nucleotide Sequence: 951 bp     [Download]
>gi|116688024|ref|NC_008542.1|:c539826-538876 Burkholderia cenocepacia HI2424 chromosome 1, complete sequence
ATGCATCGCACGATTCAGGTCCGGCGCGCGCGCCTGTCGGCCGCCGTCTCGCCCGCCCTCGCCGCGCTGT
TCGCGGCCGGCCTCGTCGCGAGCGGCGCGGCCTTCGCGCAGAACACGGGCGCGACCGTCACGCCGGTCGG
CAACGGCACGGTCGCGACGACCGCGCTGCCGCAGGCGAACCCGAACGCCGGCGGCGCGTCCGGCACGGTG
GTGCACGGCACCGCCGGCACGATCGCGCCGCCGCCCGCGAACGCGACGCCCGGCCAGGTGGTGGTCGGCG
GCAAGGTGCCCGACGAGGCGACCAAGGCCGCCGTGCTGCAGAAGCTGCGCGACACCTACGGCGCGACGAA
CGTCGTCGACCAGGTCGAGGTGGGCGACGTCGCGACGCCGCCGAACTGGAGCGCGAACGTGCAGAAGCTG
CTCGGCGCGCAGCTCAAGCAGATCAGCAAGGGCCAGTTGAAGATCAACGGCACGCAGATCGAGATGAAGG
GCGAGGTGCACAACGAGGCGCAGCGCCAGCAGCTTGCGAGCGACATGGCGAACACGCTGAACCCGACGTA
CACGATCAAGAACGGGCTGCGCGTGTCGGCGTCCGAACAGGGCGTGCTCGACCAGACGCTCGCGAACCGG
ACGATCGAGTTCGAGACCGGCAGCGCGACGCTGACGCCGCAGGGCAAGCTGATCCTCGACCAGATGGCGG
CCGCGCTGGCGAAGATGCAGAACCGCACGGTCGACATCATCGGCCACACCGACAACTCGGGGAACCGGAC
GTCGAACATCGCGCTGAGCCAGGCGCGCGCGGATGCGGTGAAGGGGTATCTGATCACGAAGAGCATTCCA
CCGCAGCAGATGACGACAACGGGGGTGGGCCCGGATCAGCCTATTGCGCCGAATGATATGGCGGATGGGC
GGGCGAGGAATCGGCGGATCGAGTTCCGGGTGGGGCAGTAA
 Primer design