SecReT6
Protein ID: 116688509
SecReT6 ID154
T6SS typei4b
Gene symbol-
Locus tagBcen2424_0485
StrainBurkholderia cenocepacia HI2424
Repliconchromosome I [GenBank: NC_008542] [Browse all T6SS(s) in this replicon]
Location [Strand]540817..544761 [-]
ProductImcF domain-containing protein
NoteTssM
UniProt IDA0K412
KEGG IDbch:Bcen2424_0485
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 1.60E-71, Aligned region: 193..451
IcmF-related [PF06761], Evalue: 3.30E-52, Aligned region: 498..569
IcmF-related [PF06761], Evalue: 3.30E-52, Aligned region: 630..877
DUF1215 [PF06744], Evalue: 1.50E-29, Aligned region: 1010..1125
Protein Sequence: 1314 a.a.     [Download]
>gi|116688509|ref|YP_834132.1| ImcF domain-containing protein [Burkholderia cenocepacia HI2424]
MQRILNVLTHPRTLSIVGIVALAAILFIVADMLQLPLLWAALAFAAVLALWLVVALWRRWRVKRANQQLG
QVLEEQAETGKIAAPAAAALAPDAKTADLDVLRTRLSDAVKTIKTSKIGQVSGGSALYELPWYIVIGNPA
AGKSSAVLNSGLQFPFADKNSAVIHGIGGTRNCDWFFTTEGILLDTAGRYSVHEEDRSEWLGFLGLLKRY
RPKAPINGIIVTASIAELTGNRPEFAINLAKNLRQRVQELTEKLEVFAPVYVMFTKADLITGFTEFFSSS
DKHEYDRVWGATLPYEPDDKRDVVAQFDTHFEELYEGLKEISVAQLSLSRGNQLSPGQLSFPLEFSTIKP
SLRAFLATLFENNPFQYKPIFRGFYFTSALQEGETNSAAAQRIAHRFGLDGSALPKPHSAFSKNGFFLRD
LFSKVIFADRQTVRQFASPTKTRLRYATFFGFVAALALALGGWTWSTIGNQQLVANVQADLDNVTRLQQG
RNDLQSRLQAMDIIEDRIEQLEQFRRDKPLSVSLGLYQGDRLEQHLLTEYYNGVRQILLAPVSQNLASFM
KDVNAHPEQLVPMTRPPESGAVQGGTLPVSTNAAGAAPQAGAMLAASGTAPAAAPQQAAAPQGGLYSDAS
PTNVQDAYNALKTYLMLSDKRHVEQAHLTDQLARFWRGWLETNRGNMPRDEMIRSAERMISFYLSRVNDD
DWPMIDANLALVDQTRENLRRVVRGMPARQRVYEEIKARASTRFAPMTIARIVGDGNQGLVAGSYAIPGT
FTREAWFDYVQPAIRDAATKELQAKDWVLNTSTQDDLTLEGSPEQIQKTLVGMYKTEYAQHWQKFMQGIA
VQGFTSFGQAVDGMNRLGDPQDSPIRKILETAYDQTSWDNPSLANVTIKKAQTGVVNWVKQLFTRSQAGQ
MAAANIDINGNPAEVPMGPIGQEFVGLARIVATHDGTSMLKGYMESLSKVRTRFNVIKNQGDPGPGARQL
MQQTLDGNGSELADSLKLVDEQMLTGLTDSQRKSLRPLLVRPLMQAFAVVIQPASAEVNKVWNAQVYQPF
QSSLATKYPFAANAKVEAGAGEIAQVFGPDGSIAKFVGTTLGPLAVRRGDTLAARTWGDMGIGLTPDFTN
GFARWVAPLAGGAAGSAAASAEPQTVFQILPQPSTGTTEYTIAIDGQQLRYRNTPPQWTNFVWPNPQGAP
GATLSATTFDGRTVQLVNEPGRYGLEKLINSAQRKRRPDGTFDLTWAQGSVNVSVTMRIISTSQPSAGGG
DQPQQQSLRGLQLPSSVADASAGAAQNATQAGTGTPGAAPAVAAANATNAQRAQ
 
Nucleotide Sequence: 3945 bp     [Download]
>gi|116688024|ref|NC_008542.1|:c544761-540817 Burkholderia cenocepacia HI2424 chromosome 1, complete sequence
ATGCAACGCATCCTCAACGTGCTGACTCATCCGCGTACGCTCTCGATCGTCGGGATCGTCGCGCTAGCGG
CCATTCTGTTCATCGTCGCCGACATGCTGCAGCTGCCGCTCCTGTGGGCGGCGCTCGCGTTCGCGGCGGT
CCTCGCGCTGTGGCTCGTCGTCGCGCTATGGCGCCGCTGGCGCGTGAAGCGCGCGAACCAGCAGCTCGGC
CAGGTGCTGGAAGAGCAGGCGGAAACCGGCAAGATCGCCGCACCGGCCGCCGCCGCGCTCGCGCCGGACG
CGAAGACGGCCGACCTCGACGTGCTGCGCACGCGCCTGTCGGATGCGGTGAAGACGATCAAGACGTCGAA
GATCGGCCAGGTGTCGGGCGGCTCCGCGCTGTACGAACTGCCGTGGTACATCGTGATCGGCAACCCAGCC
GCGGGCAAGAGCAGCGCCGTGCTCAATTCCGGCCTGCAGTTCCCATTCGCGGACAAGAACAGCGCCGTGA
TCCACGGCATCGGCGGCACGCGTAACTGCGACTGGTTCTTCACGACCGAAGGGATCCTGCTCGATACGGC
CGGCCGCTATTCGGTGCACGAGGAAGACCGTAGCGAGTGGCTCGGCTTCCTCGGGCTGCTCAAGCGCTAC
CGTCCGAAGGCGCCGATCAACGGCATCATCGTCACGGCCAGCATCGCCGAACTCACCGGCAATCGCCCCG
AATTCGCGATCAACCTCGCGAAGAACCTCCGTCAGCGCGTTCAGGAGCTGACCGAAAAGCTGGAAGTGTT
CGCGCCGGTCTACGTGATGTTCACGAAGGCCGACCTGATCACCGGCTTCACCGAATTCTTCAGCAGCAGC
GACAAGCACGAGTACGACCGCGTGTGGGGCGCCACCCTGCCCTACGAACCCGACGACAAGCGTGACGTCG
TCGCGCAGTTCGACACGCACTTCGAGGAACTCTACGAAGGGCTGAAGGAAATCAGCGTCGCGCAGCTGTC
GCTGTCGCGCGGCAACCAGCTGTCGCCGGGCCAGTTGAGCTTTCCGCTCGAATTCTCGACGATCAAGCCG
TCGCTGCGCGCGTTCCTCGCGACGCTGTTCGAGAACAACCCGTTCCAGTACAAGCCGATCTTCCGCGGCT
TCTACTTCACCAGCGCACTGCAGGAAGGCGAAACCAACAGCGCGGCCGCGCAGCGCATCGCGCACCGCTT
CGGCCTCGACGGCAGCGCGCTGCCGAAACCGCACAGCGCGTTCTCGAAGAACGGCTTCTTCCTGCGCGAC
CTGTTCTCGAAGGTGATCTTCGCGGACCGCCAGACGGTGCGCCAGTTCGCGAGCCCGACCAAGACGCGGC
TGCGCTACGCGACCTTCTTCGGCTTCGTCGCGGCGCTCGCGCTCGCGCTGGGCGGCTGGACCTGGTCGAC
CATCGGCAACCAGCAGCTCGTCGCGAACGTGCAGGCCGACCTCGACAACGTCACGCGCCTGCAGCAGGGC
CGCAACGACCTGCAGTCGCGCCTGCAGGCGATGGACATCATCGAGGACCGGATCGAGCAGCTCGAACAGT
TCCGCCGCGACAAGCCGCTGTCGGTGTCGCTCGGCCTGTACCAGGGCGACCGTCTCGAGCAGCACCTGCT
GACCGAGTACTACAACGGCGTGCGCCAGATCCTGCTGGCCCCGGTGTCGCAGAACCTCGCGTCGTTCATG
AAGGACGTGAACGCGCACCCCGAGCAGCTCGTGCCGATGACGCGCCCGCCTGAATCGGGCGCCGTGCAGG
GCGGCACGCTGCCGGTCTCGACGAACGCGGCAGGAGCCGCGCCGCAAGCGGGCGCCATGCTGGCCGCGTC
CGGCACCGCGCCGGCCGCCGCCCCGCAACAGGCGGCCGCGCCGCAGGGCGGCCTCTACAGCGACGCGTCG
CCGACCAACGTGCAGGACGCGTACAACGCGCTGAAGACCTACCTGATGCTGTCCGACAAGCGTCACGTCG
AACAGGCGCACCTGACCGACCAGCTCGCCCGCTTCTGGCGCGGCTGGCTCGAGACGAATCGCGGCAACAT
GCCGCGCGACGAGATGATCCGGAGCGCCGAGCGCATGATCTCGTTCTACCTGTCGCGCGTGAACGACGAC
GACTGGCCGATGATCGACGCGAACCTCGCGCTCGTCGACCAGACCCGCGAGAACCTGCGCCGCGTCGTGC
GCGGCATGCCGGCCCGCCAGCGCGTCTACGAGGAAATCAAGGCCCGCGCGTCGACCCGCTTCGCGCCGAT
GACCATCGCGCGCATCGTCGGCGACGGCAACCAGGGGCTCGTGGCAGGCAGCTATGCGATTCCGGGCACG
TTCACGCGCGAAGCGTGGTTCGACTACGTGCAGCCGGCGATCCGCGATGCGGCGACCAAGGAGCTGCAGG
CGAAGGACTGGGTGCTCAACACGTCGACGCAGGACGACCTGACGCTCGAGGGCAGCCCCGAGCAGATCCA
GAAGACGCTCGTCGGCATGTACAAGACCGAGTACGCGCAGCACTGGCAGAAGTTCATGCAGGGCATCGCG
GTACAGGGCTTCACCAGCTTCGGCCAGGCCGTCGACGGGATGAACCGCCTCGGCGACCCGCAGGATTCGC
CGATCCGCAAGATCCTCGAGACCGCGTACGACCAGACGTCGTGGGACAACCCGTCGCTCGCGAACGTGAC
GATCAAGAAGGCGCAGACGGGCGTCGTGAACTGGGTCAAGCAACTGTTCACGCGCTCGCAGGCCGGCCAG
ATGGCGGCAGCCAACATCGACATCAACGGCAATCCGGCCGAGGTGCCGATGGGTCCGATCGGCCAGGAAT
TCGTCGGACTCGCGCGGATCGTCGCGACGCATGACGGCACGTCGATGCTCAAGGGCTACATGGAGTCGCT
GTCGAAGGTCCGCACCCGCTTCAACGTGATCAAGAACCAGGGCGACCCGGGGCCGGGCGCGCGCCAGCTG
ATGCAGCAGACGCTCGACGGCAACGGTTCGGAACTCGCCGATTCGCTGAAGCTCGTCGACGAGCAGATGT
TGACGGGCCTGACCGATTCGCAACGCAAGTCGCTGCGCCCGCTGCTGGTGCGGCCGCTGATGCAGGCGTT
CGCGGTCGTGATCCAGCCGGCCAGCGCCGAAGTCAACAAGGTGTGGAACGCGCAGGTCTACCAGCCGTTC
CAGAGCTCGCTCGCGACCAAGTACCCGTTCGCGGCGAACGCGAAGGTCGAGGCCGGCGCCGGCGAGATCG
CGCAGGTGTTCGGTCCGGACGGCTCGATCGCGAAGTTCGTCGGCACGACGCTCGGGCCGCTCGCGGTGCG
CCGCGGCGACACGCTCGCCGCCCGCACGTGGGGCGACATGGGCATCGGGCTCACGCCGGACTTCACGAAC
GGCTTCGCACGCTGGGTCGCGCCGCTCGCGGGCGGCGCCGCCGGCAGCGCGGCCGCGTCGGCCGAACCGC
AGACCGTGTTCCAGATCCTGCCGCAACCGAGCACGGGCACGACGGAATACACGATCGCGATCGACGGCCA
GCAGCTGCGCTACCGCAACACGCCGCCGCAGTGGACCAACTTCGTGTGGCCAAACCCGCAGGGCGCGCCG
GGCGCGACGCTGTCCGCGACGACCTTCGACGGCCGCACGGTGCAGCTCGTCAACGAGCCGGGCCGCTACG
GTCTCGAGAAGCTGATCAACTCGGCGCAGCGCAAGCGCCGTCCGGACGGCACCTTCGATCTGACGTGGGC
ACAAGGCAGCGTGAACGTGTCGGTGACGATGCGCATCATCAGCACGTCGCAACCGTCGGCCGGTGGCGGC
GACCAGCCGCAGCAGCAGAGCCTGCGCGGCCTGCAGCTGCCGTCGTCGGTCGCCGACGCGAGCGCGGGCG
CCGCGCAGAACGCGACGCAAGCCGGCACCGGCACGCCGGGCGCCGCGCCGGCCGTCGCGGCCGCCAACGC
AACGAATGCACAGAGGGCGCAATGA
 Primer design