SecReT6
Protein ID: 116696351
SecReT6 ID144
T6SS typei4a
Gene symbol-
Locus tagH16_B2415
StrainRalstonia eutropha H16
Repliconchromosome II [GenBank: NC_008314] [Browse all T6SS(s) in this replicon]
Location [Strand]2725094..2726179 [-]
Producthypothetical protein
NoteTssA
UniProt IDQ0JYH7
KEGG IDreh:H16_B2415
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 1.40E-22, Aligned region: 62..122
Protein Sequence: 361 a.a.     [Download]
>gi|116696351|ref|YP_841927.1| hypothetical protein H16_B2415 [Ralstonia eutropha H16]
MTTPTQDRIPDAQALLAPVPGDDPAGASLRYDAVYRAIAEARQHDDESLPMREWERPLVKADWKRVAALA
SEALATRSKDFQLAAWLCEAWIHLHGAAGFCAGVRLLGALADAYWESAWPRMEAGDAEARCAPIAWLNET
LPAVLALHVPLLSLADEKPLHITLDLWERSLAPVDDYDSLGREALLQRAHHAPDRARLDALWRDLHGASA
EWAGFDRRIDALLGAQAPSLARVTDTLARLVRAVAALRGDEAGSAHRGEPAATGPAGNNDPVDDPEPMPV
LPAAGPGQTAMLAHGRIEDRAHAYQLIRDVADYLARHEPHSPTPYLLRRAVRWGQMPLADLMQDILREDG
DIGRYLALLDN
 
Nucleotide Sequence: 1086 bp     [Download]
>gi|116693960|ref|NC_008314.1|:c2726179-2725094 Ralstonia eutropha H16 chromosome 2, complete sequence
ATGACGACGCCAACGCAAGACCGCATCCCGGACGCGCAGGCACTGCTTGCGCCGGTGCCGGGCGACGATC
CCGCGGGCGCTTCGCTGCGCTACGACGCGGTCTATCGCGCCATCGCCGAAGCGCGCCAGCACGACGACGA
GTCCTTGCCGATGCGGGAATGGGAGCGCCCGCTGGTCAAGGCTGACTGGAAACGCGTGGCCGCGCTCGCC
AGCGAGGCGCTGGCCACGCGCAGCAAGGACTTCCAGCTGGCGGCATGGCTGTGCGAGGCGTGGATCCATC
TGCACGGCGCGGCCGGCTTTTGCGCCGGGGTGCGCTTGCTGGGGGCGTTGGCGGACGCGTATTGGGAAAG
CGCCTGGCCGCGCATGGAAGCCGGCGATGCGGAGGCACGCTGCGCCCCGATCGCATGGCTCAACGAGACC
TTGCCAGCGGTGCTGGCGCTGCATGTCCCGCTGTTGTCGCTGGCCGACGAGAAACCCCTGCACATCACGC
TGGACCTGTGGGAACGCAGCCTGGCGCCGGTCGATGACTACGACAGCCTGGGCCGCGAGGCGCTGCTGCA
GCGCGCGCATCACGCGCCCGACCGGGCCCGATTGGATGCGTTGTGGCGCGACCTGCACGGCGCCAGCGCC
GAATGGGCTGGGTTTGACCGGCGCATCGACGCGCTGCTGGGGGCGCAAGCGCCGAGCCTGGCGCGCGTAA
CCGACACGCTGGCGCGGCTGGTGCGGGCGGTGGCGGCGCTGCGCGGGGACGAAGCAGGCAGCGCTCACCG
TGGCGAACCCGCCGCCACGGGGCCGGCCGGTAACAACGATCCCGTGGACGATCCCGAGCCGATGCCGGTC
TTGCCCGCCGCGGGGCCGGGGCAGACCGCCATGCTGGCGCACGGCCGCATCGAGGACCGTGCGCATGCCT
ACCAGCTGATCCGGGATGTGGCCGACTACCTGGCGCGCCATGAGCCGCACAGCCCCACGCCATACCTGCT
GCGGCGCGCGGTGCGCTGGGGGCAGATGCCACTGGCGGATCTGATGCAGGACATCCTGCGTGAGGACGGG
GATATCGGGCGGTATCTGGCGCTGCTGGACAACTAG
 Primer design