SecReT6
Protein ID: 116696352
SecReT6 ID144
T6SS typei4a
Gene symbolicmF
Locus tagH16_B2416
StrainRalstonia eutropha H16
Repliconchromosome II [GenBank: NC_008314] [Browse all T6SS(s) in this replicon]
Location [Strand]2726176..2730294 [-]
ProductIcmF-like protein
NoteTssM
UniProt IDQ0JYH6
KEGG IDreh:H16_B2416
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 1.30E-41, Aligned region: 137..421
Protein Sequence: 1372 a.a.     [Download]
>gi|116696352|ref|YP_841928.1| IcmF-like protein [Ralstonia eutropha H16]
MLTSNLFLISIGVLTLVALAVLGAVLYFAAQRARAKPAAERKIVRLRTDSLRTAFRQAIELVEGNIASRA
ERYNIPWILVLNEGEDARPLPIAQSGVASVLGSDAANAAATQGISWHFFDRGVVIDINAAYLGSPDDDTD
EKPWDEFLGLCRGYRPQRPFDSVVVTVPAAMLLADDTDAQLELVRRAKLAHRRLWLAQNRFAVRFAVYVV
VTGCESLPGFAHFARALPEPMRAGMLGWSSPYDLSATYQSGWIDAAMSGVVRAVSDGVAELLAIGAQEVD
ACQSLLLPARIEAMRGQLTRYVDELLRPSAYHEPFYLRGVYLTGDSGELAAHAPAFAAPRLRAAQPDALA
PEDAHAPELAPAASASSSADLLNELMRQPAFLRDLFEKKIFLEYGLTRPSRSQQLARPLVHRALRWGGMA
VLCAWAGGLLVAAWQMGHRHAELLAALGELRAGAQQRALAAQRGQDLPPDWYRRQALGLIAMNQRLSAQS
VSSWFMPGSWAFIDDLDGRVHDRFQRAFGEIALDTIDRELLARVDTLTGVGRDPSTGQLIIGDSCLAPPG
ARGEALPPRSLALEDMPEMRALQQYVAAVDQFDAALQALHRLETPQPANADALRLVVRYALGAELQGEVS
GSLPYFQRDPGKGRGAASLATGGRALTALVPPLRCTFDKGARQLDERLFNNNPLLVAERAVRSSLDELAG
GANAGSGVNRVLADYRGIVAAIGTQQELLASGKGGWIRQPQFAAGTVYARTLAQAAQNRLLGEDLVAAAR
ARAESGFQAFTGELAQRFSGPDSGIAWQDKDGRFVVTPERLALRDRLAALLNQPFMAPPRDLALPSVPAG
SAVLWDRQQLDQAIALGDMRKRFLDEGLTGLPGPWRDAIAQSVDQQFARLVTDQVATAAIMAPLQADGGS
AGFEAALGRIARIKTMLGEMHAMSRVDDLDALVSRDALARLRAVDELLQQSELYAIRQGSAGDGARAPRS
PLLTAFGLNDAAALGPYLDQQSARAQALGREAAVYLAALSPADAGSGLALRWQALNRDLERYRLKNPNSR
LLMLEQFVQAAAAESGQGVCLARFAARPAGGDDYFAALHVRLYDGLLARCAQGYFADLQRQWDGFSATFN
ERLAGRAPFGGAANAGEVRTADYAELGRVLKRYEPLSATYRAARGDGPLRNIASGVPVHQFIDSFDQVRT
LLAPLYPVEEGAPAGYDVSAEFRVNRGAELAGNQIIDWTLTIGAQSLSMRDAPRSLHWDYGSPVTLTLRF
AKDSPMVALPDAEQRALAADGKTMTWRFADPWSLLSFIARHRIADPGGRADSTAQLLRFDFPLGSAAPDF
TAAPRPVRGRVFLRLVLTAAGRKMPLPWPQSFPTRAPEWTNL
 
Nucleotide Sequence: 4119 bp     [Download]
>gi|116693960|ref|NC_008314.1|:c2730294-2726176 Ralstonia eutropha H16 chromosome 2, complete sequence
ATGCTGACCAGCAACCTGTTTCTGATTTCGATCGGCGTGCTGACGCTGGTGGCGCTGGCCGTGCTCGGCG
CGGTGCTGTATTTCGCTGCGCAGCGGGCCCGCGCCAAGCCGGCGGCCGAGCGCAAGATCGTGCGCCTGCG
CACCGATTCGCTGCGCACCGCGTTCCGCCAGGCGATCGAGCTGGTCGAGGGCAATATCGCCTCGCGCGCC
GAGCGCTACAACATTCCGTGGATCCTGGTCCTGAATGAGGGCGAGGATGCGCGGCCGCTGCCGATCGCTC
AGTCCGGCGTGGCCAGCGTGCTGGGCTCCGACGCTGCCAATGCGGCCGCCACGCAGGGTATTTCATGGCA
CTTCTTTGACCGCGGCGTGGTCATCGACATCAATGCGGCCTATCTGGGCTCGCCTGACGACGATACCGAT
GAAAAGCCCTGGGACGAGTTCCTCGGCCTGTGCCGCGGCTATCGCCCGCAACGGCCCTTCGACAGCGTGG
TGGTGACGGTGCCGGCGGCGATGCTGCTGGCCGACGACACCGACGCACAGCTTGAGCTGGTGCGCCGGGC
CAAGCTGGCCCACCGGCGGCTATGGCTGGCGCAGAACCGCTTTGCGGTGCGTTTCGCGGTCTATGTGGTG
GTGACGGGCTGTGAGTCGCTGCCGGGCTTCGCGCACTTTGCGCGCGCGCTGCCAGAGCCGATGCGCGCCG
GCATGCTGGGCTGGTCCTCGCCGTACGACCTGTCGGCCACCTACCAGTCGGGCTGGATCGATGCGGCCAT
GTCGGGCGTGGTGCGCGCGGTGTCGGACGGTGTGGCCGAGCTGCTGGCGATAGGGGCGCAGGAGGTGGAT
GCCTGCCAGTCGCTGCTGCTGCCGGCGCGCATCGAAGCCATGCGCGGGCAGCTCACGCGCTATGTCGACG
AACTGCTGCGGCCCAGCGCCTATCACGAGCCCTTCTATCTGCGCGGCGTCTACCTGACCGGCGACAGCGG
CGAGCTGGCGGCGCATGCACCCGCCTTCGCCGCGCCGCGCCTGCGTGCGGCGCAGCCTGACGCACTGGCG
CCAGAGGATGCGCACGCGCCGGAGCTGGCGCCGGCAGCCAGCGCCAGCTCGTCCGCCGACCTGCTCAACG
AGCTGATGCGGCAACCGGCGTTCCTGCGCGACCTGTTCGAGAAGAAGATCTTCCTGGAGTACGGGCTGAC
GCGGCCATCGCGCTCGCAGCAGCTGGCGCGGCCGCTGGTGCACCGAGCGCTGCGCTGGGGCGGCATGGCC
GTGCTGTGCGCGTGGGCCGGGGGACTGCTGGTCGCGGCATGGCAGATGGGACATCGCCATGCCGAACTGC
TGGCCGCGCTTGGCGAACTGCGTGCCGGCGCGCAGCAGCGCGCGCTGGCCGCGCAGCGCGGCCAGGACCT
GCCGCCGGACTGGTACCGGCGCCAGGCGCTGGGGCTGATCGCGATGAACCAGCGCCTGAGCGCGCAGTCG
GTCTCGTCCTGGTTCATGCCGGGCTCGTGGGCCTTTATCGACGACCTGGACGGGCGCGTGCACGATCGCT
TCCAGCGCGCCTTCGGCGAGATCGCGCTCGACACCATCGATCGCGAACTGCTGGCACGCGTCGACACGCT
GACAGGCGTGGGGCGCGACCCGAGCACCGGCCAGCTGATCATCGGCGACAGCTGCCTGGCGCCGCCGGGC
GCACGGGGCGAGGCCCTGCCGCCACGCAGCCTGGCGCTGGAAGACATGCCGGAGATGCGCGCGCTGCAGC
AGTACGTTGCCGCGGTCGACCAGTTCGACGCTGCGCTGCAAGCGCTGCACCGGCTGGAAACGCCGCAGCC
TGCCAACGCCGATGCGCTGCGGCTGGTGGTGCGCTATGCGCTGGGGGCGGAGTTGCAGGGCGAGGTCTCG
GGCAGCCTGCCGTATTTCCAGCGCGACCCTGGCAAGGGGCGTGGTGCCGCAAGCCTGGCAACCGGCGGCA
GGGCACTGACCGCGCTGGTGCCGCCCTTGCGCTGCACCTTCGACAAGGGCGCGCGCCAGCTCGACGAGCG
GCTTTTCAACAACAACCCGCTGCTGGTGGCCGAGCGCGCCGTCAGGTCCAGCCTCGATGAACTGGCCGGC
GGGGCCAATGCCGGCAGTGGCGTCAACCGGGTCCTGGCCGACTACCGCGGCATTGTCGCGGCGATCGGCA
CGCAGCAGGAACTGCTGGCGTCCGGCAAGGGCGGCTGGATCAGGCAGCCCCAGTTCGCCGCGGGCACCGT
CTACGCGCGCACGCTGGCGCAGGCCGCGCAGAACCGGCTGCTCGGCGAAGACCTGGTGGCAGCCGCGCGC
GCACGCGCTGAAAGCGGCTTCCAGGCCTTCACCGGCGAGCTGGCGCAGCGCTTCAGCGGACCCGACAGCG
GGATCGCGTGGCAGGACAAGGACGGCCGCTTCGTGGTCACGCCCGAGCGGCTGGCCTTGCGCGACCGGCT
CGCCGCCCTGCTGAACCAGCCGTTCATGGCGCCGCCGCGCGACCTGGCGCTGCCGTCGGTGCCGGCCGGG
TCGGCGGTGCTGTGGGATCGCCAGCAGCTTGACCAGGCCATCGCCCTGGGCGACATGCGCAAGCGCTTTC
TTGACGAGGGGCTGACGGGCCTGCCAGGCCCCTGGCGCGATGCGATTGCGCAAAGCGTGGACCAGCAGTT
TGCGCGGCTGGTGACCGACCAGGTCGCGACCGCGGCAATCATGGCGCCGCTGCAGGCCGATGGCGGCAGC
GCCGGCTTCGAGGCTGCACTGGGCCGAATCGCGCGCATCAAGACCATGCTGGGCGAGATGCATGCCATGT
CGCGCGTGGATGACCTCGATGCGCTGGTTTCGCGCGATGCGCTGGCACGGCTGCGCGCGGTGGACGAGCT
GCTGCAGCAGTCCGAGCTGTACGCGATCCGGCAGGGCAGCGCCGGCGACGGGGCCCGTGCGCCGCGCTCG
CCGCTGCTGACGGCGTTCGGGCTGAACGACGCGGCGGCGCTGGGGCCGTACCTGGACCAGCAGTCGGCGC
GTGCGCAGGCCCTGGGCCGCGAGGCCGCGGTGTATCTTGCCGCGCTCTCGCCCGCCGACGCCGGCTCCGG
CCTGGCATTGCGCTGGCAGGCGCTGAACCGCGATCTGGAACGCTATCGGCTCAAGAACCCGAACAGCCGG
CTGCTGATGCTGGAGCAGTTCGTGCAGGCCGCGGCGGCCGAGTCCGGCCAGGGCGTGTGCCTGGCGCGCT
TTGCGGCGCGGCCTGCCGGCGGGGATGACTACTTTGCCGCGCTGCACGTGCGCCTGTACGACGGCCTGCT
CGCGCGCTGTGCGCAAGGCTATTTTGCCGACCTGCAGCGGCAGTGGGACGGGTTCTCGGCCACGTTCAAT
GAACGGCTGGCCGGGCGCGCGCCGTTTGGCGGCGCCGCCAACGCCGGCGAGGTGCGCACGGCGGACTATG
CCGAGCTTGGCCGGGTGCTCAAGCGCTATGAACCGCTCTCGGCGACGTACCGGGCCGCGCGTGGCGACGG
GCCGCTCAGGAATATCGCGTCCGGCGTGCCGGTGCACCAGTTCATCGACAGCTTCGACCAGGTCAGGACC
CTGCTCGCGCCACTGTATCCGGTCGAGGAGGGCGCGCCCGCGGGCTATGACGTGAGCGCGGAGTTCCGCG
TCAACCGCGGCGCGGAACTGGCCGGCAACCAGATCATCGACTGGACCCTGACGATCGGCGCGCAGAGCCT
GTCGATGCGCGATGCGCCGCGCTCGCTGCACTGGGACTACGGCAGTCCGGTGACGCTGACGCTGCGCTTT
GCCAAGGACTCACCGATGGTCGCGTTGCCTGACGCCGAACAGCGCGCGCTGGCCGCCGACGGCAAGACCA
TGACCTGGCGCTTTGCCGACCCGTGGTCGCTGCTGTCGTTCATTGCGCGCCATCGCATCGCGGATCCGGG
CGGGCGCGCCGACAGCACGGCGCAACTGCTGCGCTTCGACTTTCCGCTGGGCAGCGCCGCGCCGGATTTC
ACGGCGGCGCCCAGGCCGGTGCGCGGCCGTGTGTTCCTGCGTCTGGTGCTGACGGCCGCGGGCAGGAAGA
TGCCGCTGCCGTGGCCGCAAAGCTTTCCCACCCGGGCTCCTGAATGGACCAACCTATGA
 Primer design