SecReT6
Protein ID: 116696353
SecReT6 ID144
T6SS typei4a
Gene symbol-
Locus tagH16_B2417
StrainRalstonia eutropha H16
Repliconchromosome II [GenBank: NC_008314] [Browse all T6SS(s) in this replicon]
Location [Strand]2730332..2731084 [-]
Producthypothetical protein
NoteTssL
UniProt IDQ0JYH5
KEGG IDreh:H16_B2417
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.20E-37, Aligned region: 19..225
Protein Sequence: 250 a.a.     [Download]
>gi|116696353|ref|YP_841929.1| hypothetical protein H16_B2417 [Ralstonia eutropha H16]
MARYRPETEEDDLATGQFRAFLDELVKLQERFSEQPDLSGEAAAQGMNRQLLNLLEVQTLQSRRDSSRFE
MEDVADARYLKAVLADEILLNADWAGRAAWHGHLLESTLFRTNVAGDQVFRRIEQLLLDREPSRRNLARL
YLFTLGLGFQGRFRGADAEARLRSLREELYEFIYQRRPDLGGRERVLSESAYAHTLSHIAPRKLPTLTRW
TVVFLLGLATLLALSEVTWLWQSWPVREALRADTVAGGTP
 
Nucleotide Sequence: 753 bp     [Download]
>gi|116693960|ref|NC_008314.1|:c2731084-2730332 Ralstonia eutropha H16 chromosome 2, complete sequence
ATGGCGCGCTACCGACCGGAAACCGAGGAAGACGATCTTGCCACCGGGCAGTTCCGGGCGTTCCTGGATG
AACTCGTCAAGCTGCAGGAGCGGTTCTCCGAACAACCCGACCTCAGCGGCGAAGCTGCCGCGCAAGGCAT
GAACCGCCAGCTGCTGAACCTGCTGGAAGTGCAGACCCTGCAATCGCGGCGCGACAGCTCGCGCTTCGAG
ATGGAGGACGTGGCCGATGCCCGCTACCTGAAGGCGGTGCTCGCCGATGAAATCCTGCTGAACGCCGATT
GGGCCGGCCGCGCCGCGTGGCATGGGCATCTGCTCGAATCGACGCTGTTCCGCACCAACGTGGCAGGCGA
CCAGGTGTTTCGCCGTATCGAGCAGCTGCTGCTGGACCGCGAGCCGTCGCGCCGCAACCTGGCACGGCTG
TACCTGTTCACGCTCGGGCTTGGTTTCCAGGGGCGCTTTCGCGGCGCCGATGCCGAAGCGCGGCTGCGCA
GTCTGCGCGAGGAACTGTATGAGTTCATCTACCAACGCCGGCCAGACCTGGGCGGACGCGAGCGCGTGCT
CAGCGAATCCGCGTACGCCCACACGCTCTCGCATATCGCGCCGCGCAAGCTGCCCACGCTGACGCGCTGG
ACCGTGGTGTTCCTGCTGGGCCTGGCCACCCTGCTGGCGCTGTCCGAGGTGACGTGGCTGTGGCAATCCT
GGCCGGTGCGCGAAGCGCTGCGGGCCGACACCGTGGCCGGAGGCACGCCATGA
 Primer design