SecReT6
Protein ID: 116696354
SecReT6 ID144
T6SS typei4a
Gene symbol-
Locus tagH16_B2418
StrainRalstonia eutropha H16
Repliconchromosome II [GenBank: NC_008314] [Browse all T6SS(s) in this replicon]
Location [Strand]2731111..2732439 [-]
Producthypothetical protein
NoteTssK
UniProt IDQ0JYH4
KEGG IDreh:H16_B2418
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 3.70E-74, Aligned region: 23..427
Protein Sequence: 442 a.a.     [Download]
>gi|116696354|ref|YP_841930.1| hypothetical protein H16_B2418 [Ralstonia eutropha H16]
MSERALPVDRVEWHEGMLLAPQHLQLLAGRLDSLVAWQTLAAAPFGWGVRRLEFDAGLLPAGVVRVLQLE
AIMPDGTAVSYARDDARQPPLELALEPFADALAGGMLALYLTLPVAAANRKDGQVRRFRSVAGAPVEDEV
SEAPPADIPRLLPSLALDAGARPSPLHVSLCLGAVYKDNEIVRLGDRLPPLLEVARGSALWTAVASLVAQ
LRGKAAFVAKQTAIPSSRADDRLTQLELKDRLRSLVTALPLLEAVLRTPHLHPLALYLALASVLGSLSLL
KPGGLPPVPDDYEHADPMAVFTPLLRALRETLAEVSEEYREHKFEFRHGAFDIVLQPDWIGERLVVGLRG
QSERDLLAWMSGAVVGSQSVYPSLRTRRVLGAVRRVVEHAEDLGVRSGSGYLLFEIEADPALVHANEAMV
IGNPNEGASVQRPQEMLLFVKG
 
Nucleotide Sequence: 1329 bp     [Download]
>gi|116693960|ref|NC_008314.1|:c2732439-2731111 Ralstonia eutropha H16 chromosome 2, complete sequence
ATGTCTGAGCGCGCGCTGCCGGTCGATCGGGTTGAATGGCATGAGGGCATGCTGCTGGCGCCCCAGCATC
TCCAGCTGCTGGCCGGGCGGCTCGATTCGCTGGTGGCGTGGCAGACACTCGCGGCCGCACCGTTTGGCTG
GGGCGTGCGCCGGCTGGAGTTCGACGCCGGGCTGCTGCCGGCGGGCGTGGTGCGCGTGCTGCAGCTCGAA
GCCATCATGCCGGACGGCACTGCCGTGTCCTACGCGCGCGACGATGCCCGCCAGCCGCCGCTGGAGCTGG
CGCTCGAGCCGTTTGCCGACGCGCTTGCCGGCGGCATGCTGGCGCTTTACCTGACCCTGCCGGTGGCGGC
CGCAAACCGCAAGGACGGGCAGGTGCGGCGGTTCCGCTCGGTGGCGGGCGCCCCGGTGGAGGATGAGGTG
TCCGAAGCGCCGCCCGCCGACATTCCGCGCCTGCTGCCAAGCCTGGCACTCGATGCCGGCGCCAGGCCGT
CGCCGCTCCATGTGTCGCTGTGCCTGGGCGCGGTCTACAAGGACAACGAGATCGTGCGGCTCGGCGACCG
CCTGCCGCCGTTGCTGGAGGTGGCACGCGGCAGCGCGCTGTGGACGGCGGTGGCGTCGCTGGTGGCCCAG
CTGCGCGGCAAGGCCGCGTTCGTGGCCAAGCAGACCGCGATCCCGTCATCCCGGGCGGACGACCGCCTGA
CCCAGCTGGAACTGAAGGACCGCTTGCGCAGCCTGGTGACCGCGCTGCCGCTGCTGGAGGCGGTGTTGCG
CACGCCGCATCTGCACCCGCTTGCACTCTACCTGGCGCTGGCCTCGGTGCTGGGGTCGCTCAGCCTGCTC
AAGCCGGGCGGCCTGCCGCCGGTGCCGGACGACTATGAACACGCCGACCCCATGGCCGTGTTCACGCCGC
TGCTGCGCGCGCTGCGCGAGACCCTGGCCGAGGTCAGCGAAGAGTACCGCGAGCACAAGTTCGAGTTCCG
CCACGGCGCGTTCGACATCGTGCTGCAGCCGGACTGGATCGGCGAGCGCCTGGTGGTGGGCCTGCGCGGG
CAGTCAGAGCGCGACCTGCTGGCCTGGATGTCGGGCGCTGTGGTGGGCTCGCAGTCGGTCTACCCGTCGC
TGCGCACGCGGCGCGTGCTGGGCGCGGTGCGCCGTGTGGTCGAGCATGCCGAGGACCTTGGGGTGCGTTC
CGGCTCGGGTTACCTGTTGTTCGAGATCGAAGCCGATCCCGCGCTGGTCCATGCCAACGAGGCGATGGTG
ATCGGCAATCCCAATGAAGGCGCCAGCGTGCAGCGGCCGCAGGAAATGCTGCTGTTCGTCAAGGGCTGA
 Primer design