SecReT6
Protein ID: 116696363
SecReT6 ID144
T6SS typei4a
Gene symbol-
Locus tagH16_B2427
StrainRalstonia eutropha H16
Repliconchromosome II [GenBank: NC_008314] [Browse all T6SS(s) in this replicon]
Location [Strand]2738915..2740816 [-]
Producthypothetical protein
NoteTssI
UniProt IDQ0JYG5
KEGG IDreh:H16_B2427
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.60E-73, Aligned region: 32..327
Phage_base_V [PF04717], Evalue: 6.80E-21, Aligned region: 357..448
Gp5_C [PF06715], Evalue: 4.50E-06, Aligned region: 355..363
Gp5_C [PF06715], Evalue: 4.50E-06, Aligned region: 493..506
Gp5_C [PF06715], Evalue: 4.50E-06, Aligned region: 526..548
Gp5_C [PF06715], Evalue: 4.50E-06, Aligned region: 554..573
Protein Sequence: 633 a.a.     [Download]
>gi|116696363|ref|YP_841939.1| hypothetical protein H16_B2427 [Ralstonia eutropha H16]
MIPTQATQAGSFATLATPFGGDVLLLDGFAGREALSELFRFSLRMRSADKALDAGRIVGQRLTVTLQHPG
GAPRYLNGIVTRFAHAGADHNHGFYTAELAPRLWLLTLGRDRAIYQNLSAPQIIRRVLQSFDVAFEARIT
ETRYPMREYCVQYDESPFDFISRLMEEEGIFYFFTFADGAHTMVLADSPSAHPPGAHCADLAMHDMERPQ
AGAARMLAFGMARQLGAATQVLADYDYLQARTSQGTAQAGAAPVAQQYVFPGRHKDAADASRKAAIRAGA
QQAQAQTGMGESACHHLAAGIRFTLHGHVDPALDIAYVVRAVEHAWSGDAYGNTVSVLPLSVPFRAPLST
PRPLVAGTHTATVAGSQGEEIWTDAHGRIKLKFHWDRAPGANQDSSCWVRVAQAWAGAGWGHLFLPRMGQ
EVVVSYVDGDPDRPLVTGSVYNGQSGVPVPLPAMQTQSVIRSRASKGGSAGNELRMEDKAGAEELFLRAQ
RAMTVSVADTLSTMVEAGGESHLVKAGDLALEVRSGNETHKVSGTRQVKADGDETHTSGAAFAHDVGGNY
KLTVAGNLVIEVGGSIAFKAGTSLQCEAGTTLSSKAGTTLSNEAMMVRQKASAAQTVESGGMLELKGALV
KLN
 
Nucleotide Sequence: 1902 bp     [Download]
>gi|116693960|ref|NC_008314.1|:c2740816-2738915 Ralstonia eutropha H16 chromosome 2, complete sequence
ATGATCCCGACACAGGCCACCCAGGCCGGCAGCTTCGCGACCCTGGCCACGCCGTTTGGCGGCGACGTGC
TGCTGCTCGACGGCTTTGCCGGGCGCGAGGCGCTGTCCGAGCTGTTCCGCTTCAGCCTGCGCATGCGCTC
GGCGGACAAGGCGCTCGACGCGGGCCGCATCGTGGGCCAGCGCCTCACCGTCACGCTGCAGCACCCGGGC
GGCGCGCCCCGCTACCTGAACGGCATCGTCACGCGCTTTGCCCACGCCGGCGCCGACCACAACCATGGCT
TCTACACCGCGGAACTGGCGCCGCGGCTGTGGCTGCTGACCCTCGGGCGCGACCGCGCCATCTACCAGAA
CCTGTCCGCGCCGCAGATCATCCGCCGCGTGCTGCAGTCCTTCGACGTGGCGTTCGAGGCCCGCATCACG
GAAACGCGCTACCCGATGCGCGAGTACTGTGTGCAGTACGACGAAAGCCCGTTCGACTTCATCTCGCGGC
TGATGGAGGAGGAAGGCATCTTCTACTTCTTCACGTTCGCGGACGGCGCGCACACCATGGTGCTGGCCGA
CAGCCCGTCGGCCCACCCGCCCGGCGCGCACTGCGCCGACCTGGCGATGCACGACATGGAGCGCCCGCAG
GCCGGCGCGGCACGGATGCTCGCCTTCGGCATGGCGCGCCAGCTTGGCGCCGCGACGCAGGTTCTGGCCG
ACTACGACTACCTGCAGGCCCGGACCTCGCAGGGCACCGCCCAGGCCGGCGCGGCGCCGGTGGCGCAGCA
GTACGTGTTTCCCGGCCGGCACAAGGATGCCGCCGACGCCAGCCGCAAGGCCGCGATCCGGGCCGGCGCG
CAGCAGGCCCAGGCGCAGACGGGCATGGGCGAGAGCGCGTGCCACCACCTGGCCGCGGGCATCCGCTTCA
CGCTGCACGGCCACGTCGATCCCGCGCTCGATATCGCCTACGTGGTGCGCGCGGTGGAGCATGCCTGGAG
CGGTGATGCCTATGGCAATACCGTGTCGGTGTTGCCGCTGTCGGTGCCATTCCGCGCGCCGCTCAGCACG
CCGCGGCCGCTGGTCGCCGGCACGCACACCGCGACCGTGGCCGGGTCCCAGGGCGAAGAGATCTGGACCG
ATGCGCATGGCCGTATCAAGCTGAAGTTCCACTGGGACCGTGCGCCCGGCGCCAACCAGGACAGCTCATG
CTGGGTCCGCGTGGCGCAGGCCTGGGCCGGCGCCGGCTGGGGCCACCTGTTCCTGCCGCGCATGGGGCAG
GAGGTGGTGGTCAGCTATGTCGATGGCGACCCGGACCGGCCGCTGGTGACCGGCAGCGTCTACAACGGCC
AGTCCGGCGTACCGGTGCCGCTGCCCGCCATGCAGACGCAGAGCGTGATCCGTTCGCGCGCATCGAAGGG
CGGGTCGGCCGGCAATGAGCTGCGCATGGAAGACAAGGCTGGTGCCGAGGAGCTGTTCCTGCGCGCCCAG
CGCGCCATGACGGTTTCGGTGGCAGACACCTTGTCCACCATGGTGGAGGCGGGCGGCGAATCGCACCTGG
TCAAGGCCGGCGACCTTGCGCTCGAAGTGCGGTCCGGCAATGAAACACACAAGGTGAGCGGCACGCGCCA
GGTCAAGGCGGACGGCGACGAGACCCACACCAGCGGCGCGGCGTTTGCGCACGACGTTGGCGGCAACTAC
AAGCTCACGGTGGCCGGCAACCTGGTGATCGAGGTCGGTGGATCGATCGCGTTCAAGGCGGGAACCTCGC
TGCAGTGCGAGGCCGGCACCACGTTGAGCAGCAAGGCCGGTACCACCCTGAGCAACGAAGCCATGATGGT
CCGGCAGAAGGCGTCGGCCGCGCAGACGGTGGAAAGCGGCGGCATGCTCGAGCTCAAGGGCGCCCTGGTG
AAACTGAACTGA
 Primer design