SecReT6
Protein ID: 116696364
SecReT6 ID144
T6SS typei4a
Gene symbolclpB2
Locus tagH16_B2428
StrainRalstonia eutropha H16
Repliconchromosome II [GenBank: NC_008314] [Browse all T6SS(s) in this replicon]
Location [Strand]2740820..2743540 [-]
ProductATP-dependent protease Clp, ATPase subunit
NoteTssH
UniProt IDQ0JYG4
KEGG IDreh:H16_B2428
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 4.70E-39, Aligned region: 36..49
AAA_2 [PF07724], Evalue: 4.70E-39, Aligned region: 233..251
AAA_2 [PF07724], Evalue: 4.70E-39, Aligned region: 633..797
AAA [PF00004], Evalue: 8.40E-20, Aligned region: 65..81
AAA [PF00004], Evalue: 8.40E-20, Aligned region: 233..364
AAA [PF00004], Evalue: 8.40E-20, Aligned region: 471..495
AAA [PF00004], Evalue: 8.40E-20, Aligned region: 639..766
ClpB_D2-small [PF10431], Evalue: 6.30E-15, Aligned region: 279..300
ClpB_D2-small [PF10431], Evalue: 6.30E-15, Aligned region: 805..876
AAA_5 [PF07728], Evalue: 6.20E-13, Aligned region: 233..253
AAA_5 [PF07728], Evalue: 6.20E-13, Aligned region: 638..741
AAA_16 [PF13191], Evalue: 4.50E-11, Aligned region: 17..73
AAA_16 [PF13191], Evalue: 4.50E-11, Aligned region: 211..254
AAA_16 [PF13191], Evalue: 4.50E-11, Aligned region: 277..312
AAA_16 [PF13191], Evalue: 4.50E-11, Aligned region: 371..398
AAA_16 [PF13191], Evalue: 4.50E-11, Aligned region: 419..511
AAA_16 [PF13191], Evalue: 4.50E-11, Aligned region: 607..674
AAA_16 [PF13191], Evalue: 4.50E-11, Aligned region: 702..727
AAA_16 [PF13191], Evalue: 4.50E-11, Aligned region: 818..845
AAA_22 [PF13401], Evalue: 1.20E-10, Aligned region: 232..319
AAA_22 [PF13401], Evalue: 1.20E-10, Aligned region: 353..404
AAA_22 [PF13401], Evalue: 1.20E-10, Aligned region: 637..727
AAA_17 [PF13207], Evalue: 6.60E-06, Aligned region: 233..261
AAA_17 [PF13207], Evalue: 6.60E-06, Aligned region: 637..674
AAA_17 [PF13207], Evalue: 6.60E-06, Aligned region: 800..845
Sigma54_activat [PF00158], Evalue: 1.30E-05, Aligned region: 228..249
Sigma54_activat [PF00158], Evalue: 1.30E-05, Aligned region: 638..761
AAA_29 [PF13555], Evalue: 1.60E-05, Aligned region: 225..249
AAA_29 [PF13555], Evalue: 1.60E-05, Aligned region: 636..664
IstB_IS21 [PF01695], Evalue: 2.70E-05, Aligned region: 216..255
IstB_IS21 [PF01695], Evalue: 2.70E-05, Aligned region: 638..656
NACHT [PF05729], Evalue: 6.80E-05, Aligned region: 233..260
NACHT [PF05729], Evalue: 6.80E-05, Aligned region: 638..663
Zeta_toxin [PF06414], Evalue: 0.00011, Aligned region: 233..253
Zeta_toxin [PF06414], Evalue: 0.00011, Aligned region: 637..678
AAA_19 [PF13245], Evalue: 0.00013, Aligned region: 156..165
AAA_19 [PF13245], Evalue: 0.00013, Aligned region: 233..253
AAA_19 [PF13245], Evalue: 0.00013, Aligned region: 636..661
AAA_14 [PF13173], Evalue: 0.00015, Aligned region: 233..323
AAA_14 [PF13173], Evalue: 0.00015, Aligned region: 637..719
AAA_14 [PF13173], Evalue: 0.00015, Aligned region: 850..877
AAA_18 [PF13238], Evalue: 0.00039, Aligned region: 233..253
AAA_18 [PF13238], Evalue: 0.00039, Aligned region: 639..667
Arch_ATPase [PF01637], Evalue: 0.0011, Aligned region: 213..253
Arch_ATPase [PF01637], Evalue: 0.0011, Aligned region: 286..329
Arch_ATPase [PF01637], Evalue: 0.0011, Aligned region: 637..651
AAA_25 [PF13481], Evalue: 0.0024, Aligned region: 228..309
AAA_25 [PF13481], Evalue: 0.0024, Aligned region: 635..656
DUF815 [PF05673], Evalue: 0.0041, Aligned region: 227..276
DUF815 [PF05673], Evalue: 0.0041, Aligned region: 606..676
RNA_helicase [PF00910], Evalue: 0.0055, Aligned region: 234..254
RNA_helicase [PF00910], Evalue: 0.0055, Aligned region: 639..660
NTPase_1 [PF03266], Evalue: 0.0059, Aligned region: 233..256
NTPase_1 [PF03266], Evalue: 0.0059, Aligned region: 638..659
Protein Sequence: 906 a.a.     [Download]
>gi|116696364|ref|YP_841940.1| ATP-dependent protease Clp, ATPase subunit [Ralstonia eutropha H16]
MDIDIRTLLSRLNPECRHAMEQAAQLCVRQTHYSVDVEHLLLQLLEGGATDLQAILAHFDLAPAQVVSQL
QKAIDGFKRGNGRTPALSPNFSPLFQEAWLLSSMLLGEQQVRAGTLLLALLEVESLRGMLLESAPALLRI
PRAALREALPALLGASAVGGGPGTDAIPAAAATPAFGMPQRGPGSGQASALEQFTVDLTALARAGAIDPV
RGRDSEIRQLIDVLLRRRQNNPILTGEAGVGKTAVVEGFAQRIVSGDVPPALRQVSVRSLDLALLQAGAG
VKGEFENRLKSVIAEVAASPVPVILFIDEAHQLIGAGGSEGQGDAANLLKPALARGELRTIAATTWAEYK
KYIERDPALARRFQIVKVDEPAEAAAVDMLRGMVRKLEAHHGVEILDDAVRDAVKLSHRYVSGRQLPDKA
ISVLDTACARVAAAQSGVPEAIEALGRSIESAENQLRILRHEAATGTGRADEIAAVTRQRDEARAQHARL
SDKLATEKLAVEEILAWRRRIAAFLEKESQAEAGADGVARHEDDDNADSAESLGASLARLEKGLEAVQND
EPMVPVCVDSAAVAEVISGWTGVPVGRMLADELHTVLYLQDKLGERVVGQDEALDAIARRIRTFRADLDD
PGKPVGVFLLVGPSGVGKTETAHALADLLYGGERNMITVNMSEFQEAHSVSGLKGAPPGYVGYGRGGVLT
EAVRRRPYSVVLLDEMEKAHPDVLELFFQVFDKGVMEDGEGVPIDFRNTVILLTSNAAQDVITEASRGGR
RPPPQELVEKLRPALLRQFSPAFLARLVLVPYYHLGDAQIRNIVDLKLARLAQRFARNHNARLSWDEALA
QAITQRCTEVDSGARNVDHILTQSVLPELARRVLEQLSISEPFGGVHLSLDTGGGVAFRFLPQAGC
 
Nucleotide Sequence: 2721 bp     [Download]
>gi|116693960|ref|NC_008314.1|:c2743540-2740820 Ralstonia eutropha H16 chromosome 2, complete sequence
ATGGACATCGATATCCGCACGCTGCTCAGCCGCCTCAATCCCGAGTGCCGGCACGCGATGGAGCAGGCCG
CCCAGCTTTGCGTCCGGCAGACGCACTACAGCGTCGACGTCGAGCACCTGCTGCTGCAATTGCTGGAAGG
CGGCGCCACGGACCTGCAGGCGATCCTCGCGCACTTCGACCTGGCGCCCGCGCAGGTGGTGTCGCAGCTG
CAGAAGGCGATCGACGGCTTCAAGCGCGGCAACGGCCGCACGCCGGCGCTGTCGCCTAACTTCTCGCCGC
TGTTCCAGGAGGCCTGGCTGCTCAGTTCGATGCTGCTCGGCGAGCAGCAAGTGCGCGCCGGCACGCTGCT
GCTGGCACTGCTGGAGGTGGAAAGCCTGCGCGGCATGCTGCTGGAATCGGCGCCGGCGCTGCTGCGGATT
CCGCGTGCGGCGCTGCGCGAGGCCCTGCCCGCGCTGCTGGGGGCATCCGCCGTTGGCGGCGGGCCCGGAA
CCGATGCAATCCCGGCAGCGGCGGCCACGCCAGCGTTCGGCATGCCGCAGCGCGGACCCGGCAGCGGGCA
GGCATCGGCGCTGGAGCAGTTCACTGTCGACCTGACGGCGCTGGCGCGAGCCGGAGCGATCGATCCGGTG
CGCGGGCGCGACAGTGAAATCCGGCAACTGATCGATGTGCTGCTGCGCCGCCGCCAGAACAACCCGATCC
TGACCGGCGAGGCCGGCGTGGGCAAGACCGCGGTGGTCGAAGGCTTTGCCCAGCGCATCGTCTCCGGCGA
CGTGCCGCCGGCGCTGCGCCAAGTGTCGGTGCGCTCGCTGGACCTGGCGTTGCTGCAGGCCGGCGCCGGC
GTCAAGGGCGAGTTCGAGAACCGGCTCAAGTCCGTGATCGCCGAGGTGGCGGCCTCGCCGGTGCCGGTGA
TCCTGTTTATCGACGAAGCGCACCAGCTGATTGGCGCCGGCGGCAGCGAAGGGCAGGGCGATGCCGCCAA
CCTGCTCAAGCCCGCGCTGGCGCGCGGCGAGTTGCGCACCATTGCCGCGACCACCTGGGCCGAGTACAAG
AAGTACATCGAGCGCGACCCAGCGCTCGCGCGCCGCTTCCAGATCGTCAAGGTGGACGAGCCGGCCGAGG
CCGCGGCCGTGGACATGCTGCGCGGCATGGTGCGCAAGCTTGAAGCGCACCACGGCGTGGAGATCCTCGA
CGACGCCGTGCGCGACGCGGTCAAGCTTTCGCACCGCTATGTCTCGGGCCGGCAGTTGCCCGACAAGGCC
ATCAGCGTGCTCGACACCGCCTGCGCCCGCGTGGCGGCCGCGCAGAGCGGCGTGCCCGAGGCGATCGAAG
CGCTTGGGCGCTCGATCGAAAGCGCCGAGAACCAGCTGCGCATCCTGCGCCATGAGGCGGCCACCGGCAC
CGGGCGCGCCGACGAAATCGCTGCCGTCACGCGCCAGCGCGACGAAGCCCGGGCGCAGCACGCGCGGCTC
AGCGACAAGCTCGCCACCGAGAAGCTGGCCGTCGAGGAAATCCTGGCCTGGCGCCGCCGGATCGCGGCGT
TCCTCGAGAAGGAGAGCCAGGCCGAGGCCGGTGCCGACGGTGTGGCGAGGCATGAGGACGACGACAACGC
CGACAGCGCGGAGTCGCTTGGCGCCAGTCTCGCGCGCCTGGAAAAAGGCCTGGAGGCGGTGCAGAACGAT
GAGCCGATGGTGCCGGTATGCGTGGACTCGGCCGCAGTGGCCGAGGTCATTTCGGGATGGACCGGTGTCC
CGGTCGGCCGCATGCTGGCCGACGAACTGCACACGGTGCTGTACCTCCAGGACAAGCTCGGCGAGCGCGT
GGTGGGCCAGGACGAGGCCCTCGACGCGATCGCGCGCCGCATCCGCACGTTCCGCGCCGATCTCGATGAC
CCGGGCAAGCCGGTCGGCGTGTTCCTGCTGGTCGGCCCGAGCGGCGTCGGCAAGACCGAGACCGCGCATG
CGCTGGCCGACCTGCTCTACGGCGGCGAACGCAACATGATCACGGTCAACATGTCGGAGTTCCAGGAGGC
CCACAGCGTGTCGGGCCTGAAGGGCGCGCCGCCGGGCTATGTCGGTTACGGCCGGGGTGGCGTGCTGACC
GAGGCGGTGCGCCGCCGCCCGTACAGCGTGGTGCTGCTCGACGAGATGGAGAAGGCGCATCCCGACGTGC
TGGAGCTGTTCTTCCAGGTCTTCGACAAGGGCGTGATGGAAGACGGCGAAGGCGTGCCGATCGATTTCCG
CAACACGGTGATCCTGCTGACCTCGAACGCGGCGCAGGACGTGATCACCGAGGCCTCGCGCGGCGGCCGG
CGCCCGCCGCCGCAGGAACTGGTCGAGAAGCTGCGCCCGGCGCTGCTCAGGCAGTTCAGCCCGGCGTTCC
TGGCGCGCCTGGTGCTGGTGCCGTACTACCACCTGGGCGATGCGCAGATCCGCAATATCGTCGACCTCAA
GCTGGCGCGGCTGGCGCAGCGCTTTGCGCGCAACCACAACGCGCGCCTGAGCTGGGACGAGGCGCTGGCG
CAGGCGATCACGCAGCGCTGCACCGAGGTCGACAGCGGCGCGCGCAATGTCGACCATATCCTGACCCAGT
CGGTGCTGCCGGAACTGGCGCGGCGCGTGCTGGAGCAGCTGTCGATCTCGGAGCCGTTCGGCGGCGTGCA
TCTCTCGCTCGACACCGGCGGCGGGGTGGCGTTCCGCTTCCTGCCGCAAGCGGGGTGCTGA
 Primer design