SecReT6
Protein ID: 116696365
SecReT6 ID144
T6SS typei4a
Gene symbol-
Locus tagH16_B2429
StrainRalstonia eutropha H16
Repliconchromosome II [GenBank: NC_008314] [Browse all T6SS(s) in this replicon]
Location [Strand]2743552..2744598 [-]
Productquinoprotein dehydrogenase
NoteTssG
UniProt IDQ0JYG3
KEGG IDreh:H16_B2429
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 2.80E-77, Aligned region: 21..329
Protein Sequence: 348 a.a.     [Download]
>gi|116696365|ref|YP_841941.1| quinoprotein dehydrogenase [Ralstonia eutropha H16]
MEAMARDDGQPAAALIDRLASNPAGFDLFQAISLIERAVPGAQPVGRGNGAGEAVRLRGLVSLAFQPRDI
GAVHASAEGAGRGGRPFTLTTPVMSLAGAGGPLPLAYTEMLLERRAARDPAMGDLLDSFNHRFLSFLYRG
RRKHSPALGGQRPTGGTLAACLDALSNLGLQRGPSTANAPAGAAPWLRHAGLLGAAPRSMAGLLAMLGDR
LGLGVSGTQCLGGWLPVEASDAVRLGGRGAAGGITLGGGAVLGRRTWDQAAGIRLDVQVPGAERLRALLP
GGRDHALVAALVRAYVPQPLDVRLALHLGTRQPAGLGLGARLGWTAWLAGGAQARPAPVQLALRAHAS
 
Nucleotide Sequence: 1047 bp     [Download]
>gi|116693960|ref|NC_008314.1|:c2744598-2743552 Ralstonia eutropha H16 chromosome 2, complete sequence
ATGGAAGCAATGGCCCGCGATGACGGGCAGCCAGCAGCTGCTTTGATCGACCGCCTGGCGTCCAACCCGG
CCGGCTTCGACCTGTTCCAGGCCATCAGCCTGATCGAACGCGCGGTGCCGGGGGCTCAGCCGGTCGGCCG
CGGCAATGGCGCCGGGGAGGCGGTGCGCCTGCGCGGACTGGTCTCGCTGGCCTTCCAGCCGCGCGACATC
GGCGCGGTGCACGCGTCCGCTGAAGGCGCTGGCCGGGGCGGGCGCCCGTTCACGCTGACGACGCCCGTGA
TGTCGCTGGCGGGGGCAGGCGGGCCGCTGCCGCTCGCATACACCGAGATGCTGCTCGAACGCCGCGCCGC
GCGCGACCCCGCGATGGGCGACCTGCTCGACAGCTTCAATCACCGCTTCCTGTCCTTCCTGTATCGCGGC
CGGCGCAAGCACTCGCCCGCACTGGGCGGCCAGCGCCCGACCGGCGGCACGCTGGCGGCGTGCCTGGATG
CGCTCAGCAACCTCGGCTTGCAGCGTGGGCCCTCAACCGCCAATGCACCCGCCGGCGCGGCGCCGTGGCT
GCGCCATGCCGGGCTGCTGGGCGCGGCGCCGCGTTCGATGGCGGGGTTGCTGGCCATGCTGGGGGACCGT
CTCGGCCTGGGCGTGAGCGGGACGCAGTGTCTCGGCGGCTGGCTGCCGGTTGAAGCCAGCGATGCCGTGC
GGCTCGGCGGACGCGGTGCAGCCGGGGGTATCACGCTCGGCGGCGGTGCGGTGCTGGGGCGGCGCACCTG
GGACCAGGCCGCCGGCATCCGGCTTGATGTGCAGGTGCCCGGAGCCGAGCGCCTGCGGGCCTTGCTGCCC
GGCGGGCGCGACCACGCGCTGGTCGCGGCGCTGGTGCGCGCCTATGTGCCGCAACCGCTCGATGTGCGGC
TCGCGCTCCATCTCGGCACGCGCCAGCCCGCGGGGCTGGGGCTCGGTGCGCGCCTGGGCTGGACCGCCTG
GCTGGCCGGCGGCGCCCAGGCACGGCCCGCGCCGGTGCAACTGGCGTTGCGAGCGCACGCATCCTGA
 Primer design