SecReT6
Protein ID: 116696366
SecReT6 ID144
T6SS typei4a
Gene symbol-
Locus tagH16_B2430
StrainRalstonia eutropha H16
Repliconchromosome II [GenBank: NC_008314] [Browse all T6SS(s) in this replicon]
Location [Strand]2744553..2746328 [-]
Producthypothetical protein
NoteTssF
UniProt IDQ0JYG2
KEGG IDreh:H16_B2430
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 6.70E-177, Aligned region: 15..591
Protein Sequence: 591 a.a.     [Download]
>gi|116696366|ref|YP_841942.1| hypothetical protein H16_B2430 [Ralstonia eutropha H16]
MAEGIADGAGDGGILPYYKRELAYLRTEGAAFAERYPNVAARIALHGTESLDPHTERLIEATAYLAARVH
RDLDQVFPQVAAALLENVCPSLVQPVPSMTVVQFDLDAAQGKVTAGYAVPRHTGLHACTEGGEMCRFRTA
WDTTLWPLAVTHARMTDDNGLRLTLECADGVDFSELELGTLRIHLHGDWMVTVPLYELLVTSVAGVSVEP
PDGPPAWLPASAWREAGYGPGENVLPQPPHAQPAYGLMQEYFAFARKFHFFDLDLPAGRLGKGRSCDVVL
RLQRSAPGLGRLHAGMFRLGCVPAINLFSQTSEPIMIDHRHYEYRLVADQRREAMTEIHSIRSVVLSDPA
SDRSLAVPPFAAATDDPAEGELFWHARREPTLRANLSGTDMYLSFIDAGNVQRLPAAPVAYANVLCTNRR
LAEQVPVGARMVLEDVSQYAQVRCLYEPTVQRNPPMGSETLWPLISLLTLHHGTLAGGGTGRHEVQQMLR
LFAGDGHRQQDQVRGIRSVRARGAAAHVGTEAWRGYCRGTEVSIEFDPDAFVGGSPLLLGAVLARFLALY
ASVNSFVRLVVRRGDEIWKQWPAMTGSQQLL
 
Nucleotide Sequence: 1776 bp     [Download]
>gi|116693960|ref|NC_008314.1|:c2746328-2744553 Ralstonia eutropha H16 chromosome 2, complete sequence
ATGGCTGAGGGCATCGCAGACGGTGCCGGCGACGGCGGCATCCTGCCGTACTACAAGCGCGAGCTTGCCT
ACCTGCGCACGGAAGGCGCCGCGTTTGCCGAGCGCTATCCCAACGTGGCCGCGCGCATTGCGCTGCATGG
CACCGAATCGCTCGACCCGCATACCGAGCGCCTGATCGAAGCCACCGCCTATCTGGCGGCGCGCGTGCAT
CGCGACCTGGACCAGGTGTTCCCGCAAGTTGCCGCGGCGCTGCTGGAGAACGTGTGCCCGTCGCTGGTGC
AGCCGGTGCCGTCGATGACGGTGGTGCAGTTCGATCTCGACGCGGCCCAGGGCAAGGTGACCGCCGGCTA
CGCCGTGCCGCGCCACACCGGCCTGCATGCATGCACCGAGGGCGGCGAGATGTGCCGCTTTCGCACGGCG
TGGGACACGACGCTGTGGCCGCTGGCGGTCACGCACGCGCGCATGACCGATGACAACGGCCTGCGGCTGA
CGCTTGAATGCGCCGACGGCGTCGATTTCTCCGAGCTCGAACTGGGAACGCTGCGCATCCATCTGCACGG
CGACTGGATGGTGACCGTGCCGTTGTATGAACTGCTGGTCACCAGCGTGGCCGGCGTCAGCGTCGAGCCG
CCAGATGGCCCGCCGGCGTGGCTGCCCGCCAGCGCGTGGCGCGAGGCCGGCTACGGCCCCGGCGAGAACG
TGCTGCCGCAGCCGCCGCATGCGCAGCCGGCCTACGGGCTGATGCAGGAGTATTTCGCCTTCGCGCGCAA
GTTTCACTTCTTCGACCTGGACCTGCCCGCCGGCCGGCTCGGCAAGGGCCGCAGCTGCGACGTGGTGCTG
CGCCTGCAGCGCAGCGCACCCGGGCTGGGCCGGCTGCATGCCGGCATGTTCCGGCTTGGCTGCGTGCCGG
CGATCAACCTGTTCTCGCAGACCAGCGAGCCCATCATGATCGACCACCGGCACTATGAGTACCGGCTGGT
GGCAGACCAGCGCCGCGAGGCGATGACCGAGATCCATTCGATCCGGTCGGTGGTGCTGTCGGATCCGGCC
AGCGACCGCTCGCTGGCGGTGCCGCCGTTCGCGGCGGCCACCGACGACCCGGCCGAAGGCGAGCTGTTCT
GGCACGCGCGCCGCGAGCCGACCTTGCGGGCCAACCTGTCCGGCACCGACATGTATCTCAGCTTCATCGA
TGCGGGCAACGTGCAGCGCCTGCCGGCGGCACCCGTGGCGTACGCCAACGTGCTGTGCACCAATCGCCGG
CTCGCGGAGCAGGTGCCGGTGGGTGCGCGCATGGTGCTGGAGGATGTGTCGCAGTACGCGCAGGTGCGCT
GCCTCTATGAGCCGACCGTGCAGCGCAATCCGCCCATGGGCAGCGAGACCTTGTGGCCGCTGATCTCGCT
GCTGACGCTGCACCACGGCACCCTGGCCGGCGGTGGCACCGGGCGCCATGAGGTGCAGCAGATGCTGCGG
CTGTTCGCGGGCGACGGCCACCGCCAGCAGGACCAGGTGCGGGGCATCCGCAGCGTGCGCGCGCGCGGCG
CGGCCGCGCACGTGGGCACCGAGGCCTGGCGCGGCTACTGCCGTGGCACCGAGGTCTCGATCGAGTTCGA
TCCCGATGCCTTTGTCGGCGGCTCGCCGCTGCTGCTGGGAGCGGTGCTGGCGCGCTTCCTTGCGCTGTAT
GCCTCAGTCAATTCCTTCGTGCGGCTGGTCGTGCGCCGCGGAGACGAGATATGGAAGCAATGGCCCGCGA
TGACGGGCAGCCAGCAGCTGCTTTGA
 Primer design