SecReT6
Protein ID: 116696367
SecReT6 ID144
T6SS typei4a
Gene symbol-
Locus tagH16_B2431
StrainRalstonia eutropha H16
Repliconchromosome II [GenBank: NC_008314] [Browse all T6SS(s) in this replicon]
Location [Strand]2746321..2746776 [-]
Producthypothetical protein
NoteTssE
UniProt IDQ0JYG1
KEGG IDreh:H16_B2431
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 7.80E-18, Aligned region: 32..124
Protein Sequence: 151 a.a.     [Download]
>gi|116696367|ref|YP_841943.1| hypothetical protein H16_B2431 [Ralstonia eutropha H16]
MSVIVTGSPMPLFERLSAGANAPSAQLLQGEPLRQSVARELARLLNTRSRLTAAQFLESDGTVLDYGVPD
FSFRSFQSVPDCDAIAALVAHAIAMFEPRLRQARVRFAERDTPRPVLVIDGELPLGAAPVRVAFELAAAG
QAADPRWGDHG
 
Nucleotide Sequence: 456 bp     [Download]
>gi|116693960|ref|NC_008314.1|:c2746776-2746321 Ralstonia eutropha H16 chromosome 2, complete sequence
ATGTCCGTCATCGTCACCGGGTCGCCGATGCCGCTGTTCGAGCGGCTGTCGGCGGGTGCGAACGCCCCCT
CGGCGCAGTTGCTCCAGGGCGAGCCACTGCGCCAGTCGGTGGCGCGCGAGCTTGCCCGGCTGCTCAATAC
GCGCTCGCGGCTGACGGCGGCGCAGTTCCTGGAGTCGGACGGGACCGTGCTCGACTACGGTGTGCCGGAC
TTCTCCTTCCGCTCGTTCCAGTCGGTGCCGGACTGCGACGCGATTGCGGCGCTGGTTGCGCATGCGATCG
CGATGTTCGAGCCGCGCCTGCGCCAGGCGCGCGTACGCTTTGCCGAGCGCGACACCCCGCGCCCGGTCCT
GGTGATCGACGGCGAGTTGCCGCTGGGCGCCGCGCCGGTGCGCGTGGCGTTCGAGCTCGCCGCGGCAGGC
CAGGCCGCTGACCCGCGCTGGGGCGATCATGGCTGA
 Primer design