SecReT6
Protein ID: 116696368
SecReT6 ID144
T6SS typei4a
Gene symbol-
Locus tagH16_B2432
StrainRalstonia eutropha H16
Repliconchromosome II [GenBank: NC_008314] [Browse all T6SS(s) in this replicon]
Location [Strand]2746789..2747313 [-]
Producthypothetical protein
NoteTssD
UniProt IDQ0JYG0
KEGG IDreh:H16_B2432
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 2.10E-29, Aligned region: 6..134
Protein Sequence: 174 a.a.     [Download]
>gi|116696368|ref|YP_841944.1| hypothetical protein H16_B2432 [Ralstonia eutropha H16]
MDTIILDIPEIKGSNKQQTGRAAERIQIYSFSHGVAMAVTNDPANSKRTSGKAQFQSMTMSKKTDQATPG
LYAACAAGKSLGDVKLEIGRTEDGAFRSEMTYTLSDAIVESIQTAGGMGDSSDTFTLDFTRITAFFTQQK
GDAQKEGTAAFGWDLVENMACAVSAPPEPQKKAA
 
Nucleotide Sequence: 525 bp     [Download]
>gi|116693960|ref|NC_008314.1|:c2747313-2746789 Ralstonia eutropha H16 chromosome 2, complete sequence
ATGGACACCATCATTCTCGACATCCCCGAGATCAAGGGCAGCAACAAGCAGCAGACTGGCCGTGCCGCCG
AGCGCATCCAGATCTATTCGTTCTCGCACGGCGTGGCGATGGCCGTGACCAATGACCCGGCCAACTCGAA
GCGCACCTCGGGCAAGGCGCAGTTCCAGAGCATGACGATGTCAAAGAAGACCGACCAGGCCACGCCCGGC
CTGTACGCCGCGTGCGCCGCCGGCAAGTCGCTCGGCGATGTGAAACTCGAGATCGGACGAACCGAAGACG
GTGCGTTCCGCTCGGAGATGACCTACACGCTGAGCGACGCGATCGTCGAGTCCATCCAGACCGCTGGCGG
CATGGGCGATTCCTCCGACACGTTCACGCTCGACTTCACCCGCATCACCGCGTTCTTCACGCAACAGAAG
GGCGACGCGCAGAAGGAAGGCACGGCGGCGTTCGGCTGGGACCTGGTGGAGAACATGGCCTGCGCAGTGT
CCGCGCCGCCGGAGCCGCAGAAGAAGGCGGCGTAA
 Primer design