SecReT6
Protein ID: 116696369
SecReT6 ID144
T6SS typei4a
Gene symbol-
Locus tagH16_B2433
StrainRalstonia eutropha H16
Repliconchromosome II [GenBank: NC_008314] [Browse all T6SS(s) in this replicon]
Location [Strand]2747374..2748885 [-]
Producthypothetical protein
NoteTssC
UniProt IDQ0JYF9
KEGG IDreh:H16_B2433
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 2.20E-178, Aligned region: 76..499
Protein Sequence: 503 a.a.     [Download]
>gi|116696369|ref|YP_841945.1| hypothetical protein H16_B2433 [Ralstonia eutropha H16]
MAKNSAADNASAESKGSTTAAAERELTLLDRIVQEGNMAVEPSQSGYARKLIGQLASQILDEGMRTSPDK
SLVATINERVAEIDRLLSDQLNAIMHDPAFQALEGAWTGLHDMVYGTETGTSLKLRLLNVTKAELLKDLE
TAVDHDMSVLFKKIYEEEYGTFGGHPYTLLIGDYSFGRHPQDVALLERISKVAAAAHAPFITSAAPSLFD
LRAFTELGVTRDLAKIFESAELAQWRGFRETEDSRYVSLVLPSYAARLPYGARTNPVESFNFEEDVDGTD
HSKYLWANSAYQLGLRITDAHAKYNWSTAIRGVEGGGKVDGLVAHTYKTDEGDVALKCPTEVTITDRREK
ELNDLGFIAIVNAKGSNSATFFGSQTANKPKVYNKDQANANAQLSARLPYVLAASRFAHYLKVIMRDKVG
SFQTRGDVERYLNNWIADYVLLNPSATPEAKSRFPLSAARVDVTEVPGKPGAYRATCFLKPHFQMEELTA
SIRLVADLPAAAA
 
Nucleotide Sequence: 1512 bp     [Download]
>gi|116693960|ref|NC_008314.1|:c2748885-2747374 Ralstonia eutropha H16 chromosome 2, complete sequence
ATGGCAAAGAACTCCGCAGCGGACAACGCGAGCGCCGAATCAAAGGGGAGCACCACGGCCGCAGCCGAGC
GTGAACTGACGCTGCTCGACCGTATCGTGCAGGAAGGCAATATGGCGGTGGAGCCGTCGCAGAGCGGCTA
TGCCAGGAAGCTGATCGGCCAGCTGGCCTCGCAGATCCTTGACGAGGGCATGCGCACCAGCCCGGACAAG
AGCCTGGTGGCAACCATCAACGAGCGCGTGGCCGAGATCGACCGCCTGCTGAGCGACCAGCTCAACGCGA
TCATGCACGACCCCGCGTTCCAGGCGCTGGAAGGCGCGTGGACCGGCCTGCACGACATGGTCTACGGCAC
CGAGACCGGCACCAGCCTGAAGCTGCGCCTGCTCAACGTGACCAAGGCCGAGCTGCTGAAGGATCTTGAA
ACCGCAGTCGACCACGACATGAGCGTGCTGTTCAAGAAGATCTACGAAGAAGAGTACGGCACCTTCGGCG
GCCATCCCTACACGCTGCTGATCGGCGACTACAGCTTCGGCCGCCATCCGCAGGACGTGGCGCTGCTTGA
GCGGATATCGAAGGTGGCAGCCGCCGCCCATGCACCGTTCATCACCAGCGCGGCGCCGAGCCTGTTCGAC
CTGCGCGCTTTCACCGAGCTGGGCGTGACGCGCGACCTGGCCAAGATCTTCGAGAGCGCGGAGCTGGCGC
AGTGGCGCGGCTTCCGCGAAACCGAGGATTCGCGCTATGTGTCGCTGGTGCTGCCGTCCTACGCGGCGCG
CCTGCCTTACGGCGCCAGAACCAATCCGGTCGAGAGCTTCAATTTCGAAGAAGACGTCGACGGCACCGAC
CACAGCAAGTACCTGTGGGCCAACTCGGCCTACCAGCTGGGCCTGCGCATCACCGACGCGCATGCCAAGT
ACAACTGGTCGACCGCCATCCGCGGCGTTGAAGGCGGCGGCAAGGTCGACGGCCTGGTTGCGCATACCTA
CAAGACGGATGAAGGCGACGTCGCGCTCAAGTGCCCGACCGAGGTCACCATCACCGACCGCCGCGAGAAG
GAGCTCAACGACCTGGGCTTCATCGCCATCGTCAATGCCAAGGGCTCGAACAGCGCCACCTTCTTTGGCA
GCCAGACGGCAAACAAGCCCAAGGTCTACAACAAGGACCAGGCCAACGCCAACGCGCAGTTGTCTGCCCG
GCTGCCGTATGTGCTGGCGGCTTCGCGCTTTGCGCACTACCTGAAGGTGATCATGCGCGACAAGGTGGGC
AGCTTCCAGACGCGCGGGGACGTGGAGCGCTACCTGAACAACTGGATCGCCGACTACGTGCTGCTCAATC
CCTCCGCGACGCCGGAGGCCAAGTCGCGCTTTCCGCTGAGCGCCGCGCGCGTCGACGTGACCGAGGTGCC
GGGCAAGCCCGGCGCCTACCGTGCCACGTGTTTCCTGAAGCCGCACTTCCAGATGGAAGAACTGACCGCA
TCGATCCGCCTGGTTGCAGACCTGCCGGCAGCGGCAGCGTAG
 Primer design