SecReT6
Protein ID: 116696370
SecReT6 ID144
T6SS typei4a
Gene symbol-
Locus tagH16_B2434
StrainRalstonia eutropha H16
Repliconchromosome II [GenBank: NC_008314] [Browse all T6SS(s) in this replicon]
Location [Strand]2748949..2749485 [-]
Producthypothetical protein
NoteTssB
UniProt IDQ0JYF8
KEGG IDreh:H16_B2434
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 4.10E-53, Aligned region: 10..162
Protein Sequence: 178 a.a.     [Download]
>gi|116696370|ref|YP_841946.1| hypothetical protein H16_B2434 [Ralstonia eutropha H16]
MSNSLQKWVGRNRPPRVQISYDVEVGDAVEKRELPMVVGLLADLSGQPAVPPPKLKERRFIEIDRDNFDG
IMGKIAPRLELSVPDTMKGDTNLKVELRFDKFSDFHPESLVAQVPRLAKLLEARQQLRDLLGKLDGNDEL
DVLLERIVNNADELKLVRSEADSGAAAAQPETGDATPA
 
Nucleotide Sequence: 537 bp     [Download]
>gi|116693960|ref|NC_008314.1|:c2749485-2748949 Ralstonia eutropha H16 chromosome 2, complete sequence
ATGTCCAATAGTCTGCAGAAGTGGGTAGGGCGAAATCGCCCGCCTCGGGTCCAGATTTCATATGACGTAG
AGGTCGGTGACGCGGTCGAGAAGCGCGAGCTGCCCATGGTGGTCGGCCTGCTGGCGGACCTGTCCGGGCA
ACCGGCAGTGCCGCCGCCCAAGCTCAAGGAACGGCGCTTCATCGAGATCGACCGCGACAACTTCGACGGG
ATCATGGGCAAGATCGCGCCGCGCCTGGAGTTGTCCGTGCCCGACACCATGAAGGGCGACACCAATCTCA
AGGTCGAACTGCGCTTCGACAAGTTCAGCGACTTCCATCCCGAAAGCCTGGTGGCACAGGTGCCGCGCCT
GGCCAAGCTGCTGGAAGCACGCCAGCAACTGCGCGACCTGCTCGGCAAGCTCGATGGCAACGACGAACTC
GACGTGCTGCTCGAGCGCATCGTCAACAACGCCGATGAGCTCAAGCTGGTGCGCAGCGAAGCCGACTCCG
GCGCCGCGGCGGCACAGCCGGAAACCGGAGACGCCACGCCGGCATGA
 Primer design