SecReT6
Protein ID: 117618798
SecReT6 ID157
T6SS typei1
Gene symbol-
Locus tagAHA_1845
StrainAeromonas hydrophila subsp. hydrophila ATCC 7966
Repliconchromosome [GenBank: NC_008570] [Browse all T6SS(s) in this replicon]
Location [Strand]2014151..2017636 [+]
ProductImcF family protein
NoteTssM
UniProt IDA0KJC8
KEGG IDaha:AHA_1845
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 1.10E-88, Aligned region: 501..815
ImcF-related_N [PF14331], Evalue: 1.50E-70, Aligned region: 199..452
DUF1215 [PF06744], Evalue: 2.90E-35, Aligned region: 745..775
DUF1215 [PF06744], Evalue: 2.90E-35, Aligned region: 901..1019
Protein Sequence: 1161 a.a.     [Download]
>gi|117618798|ref|YP_856379.1| unnamed protein product [Aeromonas hydrophila subsp. hydrophila ATCC 7966]
MFKTIFTFLRQQLPKLKPSWPLLGAVLWVLALILVWWLGPRLEVRGAKPFEPLWGRVVFTLLWLWLLLGV
VSWRVWRKMQQLKAERQHEVVLEQDPVKGLIDRQALFLDRWLQALNTHLGKGALYAMPWYLVLGLPGSGK
SSLIHRANPANKLNPRLDTELRDVAQDQLVDCWLGEQAVMLDPAGVLLSQSEAELDPQARKHERLWLHLL
GWLNEHRRRQPLNGLVLTVDLAWLSHASVAERKAYAQLMRSRLQEVSATMNTRLPLYVTFTKLDLLRGFD
VIYQQLDKEARDAVLGVTFKPGADWQQDLALFWDQWVDNLNQNLPELMLSRLDAAQRNALFSFVRQLAGL
KDYVTSLLAETLAIEESKPLLVRGVYVSSVYQQGVPFDAFAQAASRRYNLPEPIHSALRGESNTYFVRQL
FSSIIFPEAHLAGENRLHTLYRRRRMAIGLSCLSLFSAALIGGWHYFYRVNEEAGRNVLTKAQAFMETNE
VADAHAFGVSQLPRLNLIREATLSFGNYRERMPLVADLGLYQGDEIGPYVEGSYLQLLSLRFLPAQMQGL
LADLNQAPAGSEEKLAILRVMRMLDDASGRNKELVAQYMASRWQKAFPGQGAVQEQLMGHLDYALDHTNW
YGARAERDQAAITAFVPFKEPVYGAQRELGKLPMYQRVYQNLVVKAGDVLPPDLNVRDEVGPTFDTVFAL
RSDNAGQVPRLLTWPGFNDFFLKQDKALIDLTAMDAWVLGQRKLSQLSEADRKEITRQVNDRYVTDYVNQ
WQKLLTNLDVQTLESPEQALDVLAAITGNDQPFQRVLASLDDNTRIRKISDVEGDPAQAISARIGRPFMA
TNGVLAGRGEQGPLIQEVNQKLVELQHYLELIVNATEPGQSALKAVQLRMTNKYADPVFALQQYARSLPA
PLDRWVGQLSEQSSRLVIDLAMSSLNQEWQDKVLTPFNSQLAGRYPFDPSSNKDVPLSEMERFFAPNGTL
DSFYQVNLKPMVESGLMEGEFSSPIQAELVKQLDRAARIRQIFFSQQGNLEVQFALEPIELTANKRRSVL
NLDGQLLEYAHGRRTKIPLVWPNTMRDGAESKITLVPAARERSPRSEGFVGPWAMFRLMDKGELTQVNDA
TFDVRFPVDQGAMTYRVYTDSAQNPFTGGLFSQFRLPESLY
 
Nucleotide Sequence: 3486 bp     [Download]
>gi|117617447|ref|NC_008570.1|:2014151-2017636 Aeromonas hydrophila subsp. hydrophila ATCC 7966 chromosome, complete genome
ATGTTCAAAACCATTTTTACTTTTCTGCGGCAACAGCTGCCGAAATTGAAACCCTCCTGGCCCCTGCTCG
GTGCTGTGCTCTGGGTGCTGGCTCTCATCCTGGTGTGGTGGCTGGGCCCTCGTCTCGAGGTGCGCGGCGC
CAAACCGTTCGAGCCGTTGTGGGGGCGGGTGGTGTTCACCCTGCTCTGGCTCTGGTTGCTGCTGGGAGTG
GTCTCCTGGCGGGTGTGGCGCAAGATGCAACAGCTCAAGGCCGAACGCCAGCACGAGGTGGTGCTGGAGC
AGGACCCGGTCAAGGGGCTCATCGACAGGCAGGCGCTGTTCCTCGATCGCTGGCTGCAGGCGTTGAATAC
CCATCTGGGCAAGGGGGCGCTCTACGCCATGCCCTGGTATCTGGTGCTGGGGCTGCCCGGCAGCGGCAAG
AGCAGCCTCATTCACCGCGCCAACCCGGCCAACAAGCTCAACCCGAGACTCGATACCGAACTGCGCGACG
TGGCGCAGGATCAGCTGGTGGATTGCTGGCTGGGGGAACAGGCGGTGATGCTGGATCCCGCCGGGGTGCT
GCTCTCCCAGAGCGAAGCCGAACTGGATCCGCAGGCCCGCAAGCATGAGCGGCTCTGGCTGCACCTGCTT
GGCTGGCTCAATGAACACCGCCGCCGCCAGCCCCTCAACGGCCTGGTGCTGACCGTGGATCTGGCCTGGC
TCTCCCACGCCAGCGTGGCCGAGCGCAAGGCCTATGCCCAGCTGATGCGCTCGCGCCTGCAGGAGGTGTC
GGCCACCATGAATACCCGGTTGCCGCTCTATGTCACCTTCACCAAGCTCGATCTGCTGCGCGGCTTTGAC
GTTATCTACCAGCAGCTCGACAAGGAGGCCCGGGATGCCGTGCTGGGGGTGACCTTCAAGCCAGGCGCCG
ACTGGCAGCAGGATCTGGCCCTGTTCTGGGATCAGTGGGTGGACAACCTCAACCAGAATCTGCCCGAACT
GATGCTGAGCCGGCTCGATGCCGCCCAGCGCAACGCGCTGTTCTCGTTCGTGCGCCAGCTGGCGGGCCTC
AAGGATTACGTGACCAGCCTGCTGGCCGAGACCCTGGCCATCGAGGAGAGCAAGCCGCTGCTGGTGCGCG
GGGTTTATGTCAGCTCCGTCTATCAGCAAGGGGTGCCGTTCGATGCGTTTGCCCAGGCGGCCTCCCGCCG
CTACAACTTGCCAGAGCCCATCCACTCGGCCCTGCGTGGGGAGTCCAACACCTACTTCGTGCGCCAGCTG
TTCTCCTCCATCATCTTCCCGGAGGCCCATCTGGCCGGCGAAAACCGGCTGCACACCCTCTATCGCCGGC
GCCGCATGGCCATCGGCCTCAGCTGCCTGTCGCTCTTCTCGGCCGCCCTCATCGGTGGCTGGCACTACTT
CTACCGGGTCAACGAGGAGGCGGGCCGCAACGTATTGACCAAGGCTCAGGCCTTCATGGAGACCAACGAG
GTGGCCGACGCCCACGCCTTCGGCGTGAGCCAGCTGCCGCGCCTCAATCTTATTCGCGAGGCGACCCTCT
CCTTTGGCAACTACCGCGAGCGGATGCCGCTGGTGGCGGATCTCGGCCTCTACCAAGGGGACGAGATTGG
TCCTTATGTGGAGGGCTCCTACCTGCAACTGCTGAGCCTGCGTTTCCTGCCGGCCCAGATGCAGGGATTG
CTGGCGGATCTCAACCAGGCGCCTGCCGGCAGCGAGGAGAAGCTCGCCATCCTGCGGGTGATGCGGATGC
TGGACGATGCGTCCGGTCGCAACAAGGAGCTGGTGGCGCAGTACATGGCGAGCCGTTGGCAGAAGGCCTT
CCCGGGGCAGGGGGCGGTACAGGAGCAGCTGATGGGGCACCTGGACTATGCCCTCGACCACACCAACTGG
TATGGCGCCAGGGCCGAGCGGGATCAGGCCGCCATCACCGCCTTCGTGCCGTTCAAGGAGCCGGTCTACG
GTGCCCAGCGCGAGCTCGGCAAGCTGCCCATGTATCAGCGGGTCTACCAGAACCTGGTGGTGAAGGCGGG
CGATGTATTGCCGCCGGATCTCAACGTCCGTGACGAGGTGGGCCCCACCTTTGACACCGTGTTTGCCCTG
CGCAGCGACAACGCCGGCCAGGTGCCGCGGCTGCTCACCTGGCCCGGTTTCAACGACTTCTTCCTGAAAC
AAGACAAGGCGCTCATCGATCTCACCGCGATGGATGCCTGGGTGCTGGGCCAGCGCAAGCTGAGCCAGTT
GAGCGAGGCAGATCGCAAGGAGATCACCCGTCAGGTCAACGACCGTTACGTCACCGATTACGTCAACCAG
TGGCAAAAACTGCTGACCAATCTGGACGTGCAGACCCTGGAGAGCCCGGAGCAGGCGCTGGACGTGCTGG
CCGCCATTACTGGCAACGATCAGCCGTTCCAACGGGTACTGGCCTCGCTGGATGACAACACCCGCATTCG
CAAGATCTCCGATGTGGAAGGGGACCCGGCCCAGGCCATCAGCGCCCGCATCGGTCGTCCCTTTATGGCC
ACTAATGGAGTATTGGCTGGACGTGGCGAGCAGGGACCGCTCATTCAGGAGGTCAACCAGAAGCTGGTGG
AGCTGCAGCACTACCTGGAGCTCATCGTCAACGCCACCGAGCCGGGCCAGTCCGCCTTGAAAGCGGTGCA
GCTGCGCATGACCAACAAGTACGCCGATCCGGTGTTCGCCCTGCAGCAATATGCCCGCAGTCTGCCGGCC
CCGCTCGATCGCTGGGTGGGTCAGCTCTCCGAGCAGAGCTCGCGGCTGGTGATCGACCTGGCCATGTCCT
CCCTCAATCAGGAGTGGCAGGACAAGGTGCTGACCCCCTTCAACAGCCAGCTGGCCGGTCGTTATCCGTT
TGATCCGAGCTCGAACAAGGATGTGCCCCTCTCCGAGATGGAGCGCTTCTTTGCGCCTAACGGGACGCTG
GACAGCTTCTATCAGGTCAACCTCAAACCCATGGTGGAGAGCGGCCTGATGGAAGGGGAGTTCAGCTCGC
CCATCCAGGCCGAGCTGGTCAAGCAGCTGGACCGTGCGGCCCGCATCCGTCAGATCTTCTTCAGCCAGCA
GGGCAACCTGGAGGTGCAGTTCGCCCTCGAGCCCATCGAGCTCACCGCCAACAAGCGGCGCAGTGTGCTG
AACCTGGACGGCCAGCTACTGGAATATGCCCATGGCCGTCGTACCAAGATCCCGCTGGTGTGGCCCAATA
CCATGCGCGACGGGGCGGAGAGCAAGATCACTCTGGTGCCGGCCGCCCGCGAGCGCTCACCACGCAGCGA
AGGCTTCGTCGGTCCCTGGGCAATGTTCCGTCTGATGGACAAGGGGGAGCTGACCCAGGTCAATGACGCC
ACCTTCGATGTGCGCTTCCCGGTGGATCAGGGGGCCATGACCTATCGCGTCTACACCGACAGCGCGCAAA
ACCCCTTCACCGGCGGCCTGTTCAGCCAGTTCAGACTGCCTGAATCCCTCTATTGA
 Primer design