SecReT6
Protein ID: 117625053
SecReT6 ID156
T6SS typei2
Gene symbol-
Locus tagAPECO1_3705
StrainEscherichia coli APEC O1
Repliconchromosome [GenBank: NC_008563] [Browse all T6SS(s) in this replicon]
Location [Strand]3133547..3136885 [+]
Producthypothetical protein
NoteTssM
UniProt IDA1AF12
KEGG IDecv:APECO1_3705
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 2.30E-66, Aligned region: 400..717
IcmF-related [PF06761], Evalue: 2.30E-66, Aligned region: 779..822
DUF1215 [PF06744], Evalue: 1.50E-35, Aligned region: 434..467
DUF1215 [PF06744], Evalue: 1.50E-35, Aligned region: 840..959
Protein Sequence: 1112 a.a.     [Download]
>gi|117625053|ref|YP_854041.1| unnamed protein product [Escherichia coli APEC O1]
MHTQRYGFWGYLILIIGLAGICALLIIINQDVLIKSGVSARLIWGIWAGLFSLFLLGVVCSPFWWIRKQR
KAQFIYRPKNSAENDQPVSSPSEDILTDLSSNIRLRYGPFWRRKVRLLLVTGEPEEAEAIAPGLTGQHWL
EGDHTVLIYGGRPTAEPDVTLLTALKKLRRSRPLDGIIWPLTEEQSRQTAQLDKGWRELINGGKRLGFQA
PLYLWQVCDDGDYQTGRPLQSVGCLLPERCTPEQLAVMLEAQTLPLTEQGMSQLLADNRHDFLLRLAHTL
AERGIAHWQSVLKPLLAGGAFSSLRLRGLMFSPPLAAVPEAAPHAWLPSPVWAGVTGDNARGRTVGFPWL
RTALMSAVCVLVIWGAGMTTSFFANRALVQETGIQTARALDTRLPLAEQLVALHTLQGELERLQYRIREG
APWYQRFGLERNQQLLAAAFPGYAQAANRLVRDVAVDHLQQQLNAFVALPPNSPQRTATGEQRYKQLKAL
LMTSRPEKADAAFFSTTLMADGLRYENIPEGVRQSVLPSLLTFWTANLPEHPQWKTSPPPELTGAVRKIL
LRQIGVRNAENTLYQNVLQQVSRNYADMTLADMTGDTLTESLFSTEQTVPGMFTRQAWEGQVREAIEQVV
TARREEIDWVLSDRQQDTSADISPDTLRNRLTSRYFTDFAGSWLAFLNSIRWKKEDSLSGILDQLTLMAD
ARQSPLIALTDTLAWQAAAGRENRGLSDSLAKSAQELFNGKEKTPQQSREGNEPVGPLDKTFAPLLRLLG
DKAGGGGGDTQLSLQTYLTRVTRVRLKLQQVTNAPDPQEMTQQLAQTVLQGKTVDLTDTRDYGRLIAASL
GEEWSGFGQALFVRPVEQSWRQVLTPAADSLNRQWQRAIVSHWNQDFAGRYPFKASQNDASLPLLAQYLR
DDGRINQFIAANLSGVLKREGRYWVADAMNTQGLTVNPDFIRALNRLRDVADTAFASGDAGIHFELRAKP
ARDVMKTHLVIDGQELEYFNQKERWQRFNWPDEQWQPGASLSWTSTQAMERILADYRGSWSLIRLLEQAQ
VTPVDSSTFKVVWKAQDGLPLNYLLRVEQGKGPLALLELKNFRLPGQVFLTGRSAYYREGDR
 
Nucleotide Sequence: 3339 bp     [Download]
>gi|117622295|ref|NC_008563.1|:3133547-3136885 Escherichia coli APEC O1 chromosome, complete genome
ATGCATACTCAGCGTTACGGTTTCTGGGGATATTTAATTCTGATTATTGGTTTGGCAGGGATTTGCGCTC
TGTTAATTATTATTAATCAGGATGTTCTGATAAAGAGCGGAGTGTCTGCTCGTCTGATATGGGGAATATG
GGCGGGATTATTTTCTCTTTTTTTACTTGGGGTTGTGTGTTCGCCGTTCTGGTGGATCCGGAAGCAAAGG
AAAGCGCAATTTATTTACAGACCAAAAAATTCGGCAGAAAACGACCAACCCGTATCTTCTCCATCAGAGG
ATATTTTAACCGATCTCAGCTCAAATATTCGGTTACGCTATGGTCCGTTCTGGCGGCGTAAAGTCCGCCT
GCTGCTGGTGACCGGCGAGCCTGAAGAGGCAGAGGCCATCGCGCCGGGGCTGACCGGGCAACACTGGCTG
GAGGGCGACCACACCGTGCTGATATATGGCGGCAGGCCAACAGCGGAGCCTGATGTCACACTGCTGACCG
CCTTAAAAAAACTGCGCCGCAGCCGTCCGCTGGACGGCATCATCTGGCCGCTGACAGAAGAACAAAGCCG
CCAGACCGCACAACTCGACAAAGGCTGGCGCGAACTGATAAACGGCGGTAAGCGACTCGGTTTTCAGGCT
CCACTCTATTTGTGGCAGGTCTGTGACGACGGTGATTATCAGACCGGACGCCCCCTGCAAAGCGTCGGCT
GCCTGCTGCCGGAACGCTGTACCCCGGAACAACTGGCTGTAATGCTGGAAGCACAAACCCTGCCGCTGAC
GGAACAGGGCATGTCGCAACTGCTGGCGGATAACCGCCATGATTTCCTGCTGCGTCTGGCCCATACCCTT
GCAGAGCGGGGTATCGCTCACTGGCAAAGCGTTCTGAAACCGCTGCTGGCAGGCGGCGCATTTTCTTCCC
TGCGCCTGCGTGGCCTGATGTTCAGCCCGCCGCTTGCCGCCGTGCCGGAGGCCGCACCTCATGCGTGGCT
GCCGTCACCGGTCTGGGCGGGCGTGACGGGTGATAACGCGCGCGGGCGCACGGTGGGTTTTCCGTGGCTG
CGTACCGCACTGATGTCCGCTGTCTGCGTGCTGGTGATATGGGGGGCCGGAATGACGACCTCGTTCTTCG
CCAACCGCGCTCTTGTTCAGGAAACCGGTATCCAGACGGCGCGTGCGCTCGATACCCGCCTGCCGCTGGC
AGAACAACTGGTGGCGCTGCATACCCTGCAGGGCGAACTGGAACGCCTGCAATACCGTATCCGCGAAGGT
GCGCCGTGGTATCAGCGTTTTGGCCTTGAACGTAACCAACAACTGCTCGCCGCCGCTTTTCCCGGCTATG
CGCAGGCGGCAAACCGGCTGGTGCGCGACGTGGCCGTTGACCATCTGCAACAGCAACTTAATGCCTTTGT
CGCGCTGCCGCCCAACAGTCCTCAGCGTACCGCCACCGGTGAACAACGCTATAAGCAGCTTAAGGCATTG
CTGATGACTTCCCGCCCGGAAAAGGCCGACGCTGCCTTTTTCAGTACCACGCTGATGGCGGACGGTCTGC
GCTACGAGAATATCCCGGAAGGTGTGCGGCAGAGCGTGTTGCCGTCACTGCTGACCTTCTGGACGGCGAA
CCTGCCGGAACACCCGCAGTGGAAAACATCGCCGCCACCGGAACTGACCGGCGCAGTGCGTAAAATCCTG
CTGCGCCAGATTGGTGTGCGTAATGCCGAAAACACCCTCTACCAGAACGTGCTGCAACAGGTGTCCCGCA
ACTACGCCGATATGACGCTGGCGGACATGACCGGGGATACCCTCACCGAATCTCTTTTCAGTACGGAACA
GACGGTGCCGGGGATGTTCACCCGTCAGGCGTGGGAAGGACAGGTCAGGGAAGCCATCGAGCAGGTGGTG
ACGGCGCGGCGCGAGGAAATCGACTGGGTACTCAGCGACCGCCAGCAGGATACCTCTGCGGATATCTCGC
CGGATACGCTGCGTAACCGTCTCACCTCACGCTACTTTACCGACTTTGCCGGAAGCTGGCTGGCGTTTCT
CAACAGCATTCGCTGGAAAAAGGAAGACTCGCTCTCCGGCATTCTCGACCAGCTGACACTGATGGCCGAT
GCCCGTCAGTCGCCACTGATTGCGCTGACGGACACCCTCGCGTGGCAGGCGGCGGCAGGCAGGGAAAACC
GTGGCCTGTCAGACTCGCTGGCGAAATCGGCACAGGAACTGTTTAACGGCAAGGAGAAAACGCCGCAGCA
ATCCCGTGAAGGCAACGAGCCTGTCGGGCCGCTGGATAAAACCTTCGCGCCGCTACTGCGGTTGCTGGGC
GATAAGGCAGGAGGCGGTGGTGGTGATACGCAACTCAGCCTGCAAACGTATCTGACCCGCGTCACCCGCG
TGCGTCTCAAACTGCAACAGGTGACCAACGCCCCCGACCCGCAGGAGATGACCCAGCAACTGGCGCAGAC
GGTTTTACAGGGCAAAACCGTTGACCTCACCGACACCCGCGACTACGGACGGTTAATCGCCGCCAGTCTG
GGCGAGGAATGGAGTGGCTTCGGTCAGGCGCTGTTCGTCCGCCCGGTGGAGCAGTCGTGGCGGCAGGTGC
TGACGCCTGCGGCGGACAGCCTGAACCGTCAGTGGCAGCGGGCGATAGTCAGCCACTGGAATCAGGACTT
CGCCGGGCGCTATCCGTTCAAAGCCTCACAAAACGATGCCTCTCTTCCCCTGCTGGCACAGTATCTGCGC
GATGACGGGCGCATCAACCAGTTTATCGCCGCCAACCTTTCCGGTGTTCTGAAACGTGAAGGCCGCTACT
GGGTGGCTGACGCCATGAACACGCAGGGGCTGACGGTTAACCCGGACTTTATCCGCGCCCTGAACCGCCT
GCGTGACGTGGCCGACACCGCCTTTGCCAGCGGCGATGCGGGAATACATTTCGAACTGCGGGCAAAACCG
GCGCGTGACGTGATGAAAACGCATCTGGTGATTGACGGGCAGGAGCTGGAATATTTCAACCAGAAGGAAC
GCTGGCAGCGTTTCAACTGGCCGGATGAACAGTGGCAACCCGGCGCATCGCTGAGCTGGACCAGCACGCA
GGCGATGGAACGCATTCTGGCGGATTACCGGGGAAGCTGGAGCCTTATTCGCCTGCTGGAACAGGCGCAG
GTGACACCGGTGGACAGCAGCACCTTTAAGGTGGTGTGGAAAGCGCAGGATGGCCTGCCGCTGAATTACC
TGCTGCGGGTTGAACAGGGTAAAGGGCCGCTGGCGCTGCTGGAGCTGAAAAACTTCCGCCTGCCGGGACA
GGTATTTCTGACCGGCAGGAGTGCGTATTACCGTGAAGGAGATCGGTGA
 Primer design