SecReT6
Protein ID: 119385180
SecReT6 ID159
T6SS typei3
Gene symbol-
Locus tagPden_2453
StrainParacoccus denitrificans PD1222
Repliconchromosome 1 [GenBank: NC_008686] [Browse all T6SS(s) in this replicon]
Location [Strand]2459594..2463124 [+]
ProductImcF domain-containing protein
NoteTssM
UniProt IDA1B4U6
KEGG IDpde:Pden_2453
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 9.20E-86, Aligned region: 188..446
IcmF-related [PF06761], Evalue: 2.30E-69, Aligned region: 237..264
IcmF-related [PF06761], Evalue: 2.30E-69, Aligned region: 499..800
DUF1215 [PF06744], Evalue: 1.70E-36, Aligned region: 916..1036
AAA_16 [PF13191], Evalue: 0.00021, Aligned region: 123..263
AAA_16 [PF13191], Evalue: 0.00021, Aligned region: 443..479
AAA_19 [PF13245], Evalue: 0.0077, Aligned region: 127..141
AAA_19 [PF13245], Evalue: 0.0077, Aligned region: 232..242
Protein Sequence: 1176 a.a.     [Download]
>gi|119385180|ref|YP_916236.1| unnamed protein product [Paracoccus denitrificans PD1222]
MRILKAIFRFFLSRGFWTFVGLALLAAAIWFYGPLVSVGEAAPLESAEVRALCLGAILVLWLLILLVGQI
RAARRNRMFVTELAAPPPLPDTPDAAAEIGGKFQEILATLARSRLGKRRFLREMPWYVIIGPPGTGKTTA
LRQSGLNFPIALNDDLKGVGGTRNCDWFFTENAVLVDTAGRYTDQSSEPERDAAEWAGFLDLLKRHRGRR
ALNGVIVALSLDELLGPEDALRRHAREIRKRLTEIAERLEMQLPVYLMLTKADRLPGFETFFGALTSAER
AQVWGATLPVDALPEPEAITREFRSLAAVLEGRLDARLAEDADLPQRAAIFRFPAEFERLEAPLRLLIDT
AFGESRYEQTPWLRGFYLSSATQEGSPLDRMLAGMAAGFGLAPAPVPHRAMGERRSFFLHDLLAGVIFGE
AGLGLFDPRAEERRTWIWRGSAVAAALLVLLAGLGFLFNTMRQSGAVADQQRLLADLAGRLANAASRQAP
TEPLDLPVALDAMTEIEAARTPVPGGPLALIGPSAAAEIEGAARLARERGLRNLLEPRMVAFLEATMWRQ
IRDPDFLLGALKAYQMLTGLGPYDRAWLAEWWQEVLPAFAAETPFPTEAARLWQLAALDRLGGDESRIEA
NPQLVEAALQAICTVPLSLRTYRALMSEPEIATLPDWIPAEKAGPLAGQVLTRLSGQTLRQGIPGAFTWQ
GFHGTVLPMLPGMAEAALNDRKVFAGGCAESADASAASLQADMMKLYQDDFINAWEGFLRDVRLAPIPDL
ATATANLKDLASPDSTLKRLLNAVVAETDLARPPEQGDSPEINPGVLKKVAGKLGLGAAARIGTKVAAAA
RRPGEPEPPPPGAEIARHFAPLKAIVAEVDGKPPLIADAETALGALSKELLTVQASPDPQAALLSRGGLP
QLTGDLRNVAATLPDPVNAWLGAIAGDTISVTREAILAQLNARWRADVLPFCRAATGGRYPFVADSAIDV
TVSDFQQLFGPGGRFDGFTNETLAPYVDTSARPWRWRADLGLDARTLAPFEQARAIRDALFPGGAGPVMA
FTLEPKDLTPNAARVTLNVDGQSLVYFNAAARPMPMTWPGKDGTNLISLSFTPVDGTGEAISTETGAWAW
LRLVRKAGLSPTALPEVFGLRLGIGPYAARFELRAASVENPFDLSMFGAFRCPEAF
 
Nucleotide Sequence: 3531 bp     [Download]
>gi|119382757|ref|NC_008686.1|:2459594-2463124 Paracoccus denitrificans PD1222 chromosome 1, complete sequence
ATGCGTATCCTCAAGGCCATATTCCGGTTCTTCCTGTCTCGCGGCTTCTGGACCTTCGTCGGGCTGGCGC
TGCTGGCGGCAGCGATCTGGTTCTATGGCCCGCTGGTTTCGGTCGGCGAGGCGGCACCGCTGGAAAGCGC
CGAGGTCCGCGCGCTCTGCCTGGGCGCCATCCTGGTTCTGTGGCTGCTGATCCTGCTGGTCGGCCAGATC
CGCGCCGCGCGGCGCAACCGCATGTTCGTCACCGAACTGGCCGCGCCACCGCCCCTGCCCGACACGCCCG
ATGCGGCGGCCGAGATCGGCGGCAAGTTCCAGGAGATCCTGGCGACACTGGCGCGCTCGCGCCTGGGCAA
GCGGCGCTTTTTGCGCGAGATGCCCTGGTATGTCATCATCGGCCCACCCGGCACCGGCAAGACCACGGCG
CTGCGCCAGTCGGGGCTGAACTTTCCCATCGCGCTGAACGACGACCTCAAGGGGGTTGGCGGCACGCGAA
ACTGCGACTGGTTCTTTACCGAAAACGCCGTGCTGGTCGACACCGCCGGCCGCTATACCGACCAGTCCAG
CGAACCCGAGCGCGATGCGGCGGAATGGGCCGGCTTCCTCGACCTGCTGAAAAGGCATCGCGGCCGGCGG
GCGCTGAACGGGGTAATCGTCGCCCTGTCGCTGGACGAGTTGCTGGGCCCCGAGGACGCGCTGCGCCGCC
ACGCGCGCGAGATCCGCAAGCGCCTGACCGAGATCGCCGAGCGGCTGGAGATGCAGCTGCCGGTCTATCT
GATGCTGACCAAGGCCGACCGGCTGCCGGGCTTCGAGACGTTCTTCGGCGCGCTGACCTCGGCCGAGCGG
GCGCAGGTCTGGGGCGCCACCCTGCCGGTCGACGCCCTGCCCGAGCCCGAGGCGATCACCCGCGAGTTTC
GCAGCCTCGCCGCCGTGCTGGAGGGCCGGCTGGACGCACGGCTGGCCGAGGATGCCGACCTGCCGCAGCG
CGCCGCGATCTTCCGCTTTCCGGCCGAGTTCGAGCGGCTGGAGGCGCCGCTCCGGCTGCTGATCGACACC
GCCTTCGGCGAAAGCCGCTATGAGCAGACGCCCTGGCTGCGCGGCTTCTACCTGAGCTCGGCCACGCAGG
AGGGCTCGCCGCTGGACCGGATGCTGGCGGGGATGGCGGCGGGCTTCGGCCTTGCGCCCGCGCCGGTGCC
GCATCGCGCGATGGGCGAGCGGCGGTCGTTCTTCCTGCACGACCTGCTGGCCGGGGTGATCTTCGGCGAG
GCGGGCTTGGGCCTGTTCGATCCGCGCGCCGAGGAGCGCCGGACATGGATCTGGCGCGGCTCGGCCGTGG
CGGCGGCGCTGCTGGTGCTGCTGGCGGGCCTGGGCTTTCTGTTCAACACCATGCGCCAGTCCGGCGCGGT
TGCGGACCAGCAGCGCCTGCTGGCCGACCTTGCGGGGCGGCTTGCCAACGCCGCCTCGCGACAGGCCCCG
ACCGAGCCCCTGGACCTGCCCGTCGCCCTTGACGCCATGACCGAGATCGAGGCGGCCCGGACGCCGGTGC
CCGGCGGGCCGCTGGCGCTGATCGGCCCCTCGGCTGCGGCCGAGATCGAGGGCGCGGCCCGGCTGGCACG
CGAACGCGGACTGCGCAACCTCCTGGAGCCGCGCATGGTCGCCTTTCTGGAGGCGACGATGTGGCGGCAG
ATCCGCGACCCGGATTTCCTGCTGGGCGCGCTGAAAGCCTATCAGATGCTGACCGGGCTTGGTCCCTATG
ACCGCGCCTGGCTCGCGGAATGGTGGCAGGAGGTGCTGCCCGCCTTTGCCGCCGAGACCCCCTTCCCGAC
CGAGGCCGCGCGCCTGTGGCAGCTTGCCGCGCTGGACCGGCTGGGCGGCGACGAAAGCCGCATCGAGGCC
AATCCGCAGCTGGTCGAGGCCGCCTTGCAGGCGATCTGCACCGTGCCCTTGTCGCTGCGCACCTATCGCG
CGCTGATGTCCGAACCCGAGATCGCCACCCTGCCCGACTGGATACCGGCGGAAAAGGCCGGGCCGCTGGC
GGGGCAGGTGCTGACGCGGCTGTCGGGCCAGACCCTGCGCCAGGGCATTCCCGGCGCCTTTACCTGGCAG
GGCTTTCACGGCACGGTGCTGCCGATGCTGCCCGGCATGGCCGAGGCGGCGCTGAACGACCGCAAGGTCT
TTGCCGGCGGCTGCGCGGAAAGCGCCGATGCCTCGGCCGCCTCGCTGCAAGCCGACATGATGAAGCTTTA
CCAGGACGATTTCATCAATGCCTGGGAGGGGTTCCTGCGCGACGTGCGGCTGGCGCCGATCCCCGACCTG
GCCACCGCCACCGCGAACCTGAAGGACCTTGCCAGCCCCGACAGCACGCTGAAGCGGCTGCTGAACGCCG
TCGTCGCCGAAACCGACCTGGCGCGACCGCCCGAACAGGGCGACAGCCCCGAGATCAATCCCGGCGTGCT
GAAGAAGGTGGCCGGCAAGCTGGGCCTTGGCGCCGCAGCCAGGATCGGCACCAAGGTCGCCGCCGCCGCC
CGCCGTCCGGGAGAGCCCGAGCCGCCGCCGCCCGGGGCCGAGATCGCCCGGCATTTCGCCCCGCTCAAGG
CCATCGTCGCCGAGGTGGACGGCAAGCCGCCGCTGATCGCGGATGCCGAGACGGCGCTGGGGGCGCTGTC
CAAGGAGCTTCTGACCGTGCAGGCCAGCCCCGATCCGCAGGCGGCGCTGTTGTCGCGCGGCGGGCTGCCG
CAATTGACGGGCGATCTGCGCAATGTCGCGGCCACCCTGCCCGACCCGGTCAACGCCTGGCTGGGCGCCA
TCGCCGGCGACACGATCAGCGTCACGCGCGAGGCGATCCTGGCCCAGCTCAACGCGCGCTGGCGGGCGGA
TGTGCTGCCCTTCTGCCGCGCGGCGACGGGGGGGCGCTATCCCTTCGTCGCGGATTCGGCCATCGACGTG
ACGGTCAGCGACTTCCAGCAGCTTTTCGGACCCGGCGGCCGCTTCGACGGCTTCACCAACGAGACGCTGG
CGCCCTATGTCGATACCAGCGCGCGGCCCTGGCGCTGGCGGGCCGACCTGGGGCTGGACGCCCGCACGCT
GGCCCCGTTCGAACAGGCCCGCGCCATCCGCGACGCACTGTTTCCGGGTGGTGCCGGGCCGGTCATGGCC
TTTACGCTGGAGCCGAAGGACCTGACCCCCAATGCCGCGCGGGTGACGCTGAACGTGGACGGGCAGAGCC
TGGTCTATTTCAACGCCGCCGCCCGGCCGATGCCGATGACCTGGCCGGGCAAGGACGGCACCAACCTGAT
CTCGCTGAGCTTCACCCCGGTGGATGGCACGGGCGAGGCGATCAGCACCGAAACCGGCGCCTGGGCCTGG
CTGCGGCTGGTGCGCAAGGCCGGGCTGTCGCCCACCGCGCTGCCCGAGGTCTTTGGCCTGCGGCTGGGCA
TCGGCCCCTATGCCGCCCGGTTCGAACTGCGCGCGGCTTCGGTCGAGAATCCCTTCGATCTCAGCATGTT
CGGTGCCTTCCGATGCCCGGAAGCGTTCTAG
 Primer design