SecReT6
Protein ID: 119385183
SecReT6 ID159
T6SS typei3
Gene symbol-
Locus tagPden_2456
StrainParacoccus denitrificans PD1222
Repliconchromosome 1 [GenBank: NC_008686] [Browse all T6SS(s) in this replicon]
Location [Strand]2466042..2468447 [-]
Producthypothetical protein
NoteTssM
UniProt IDA1B4U9
KEGG IDpde:Pden_2456
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 2.70E-32, Aligned region: 195..482
DUF1215 [PF06744], Evalue: 2.60E-21, Aligned region: 556..668
Protein Sequence: 801 a.a.     [Download]
>gi|119385183|ref|YP_916239.1| unnamed protein product [Paracoccus denitrificans PD1222]
MAGRREALTAVAGRLAQPVLAYAERLPWVAEDMAALAGHARVLLDRFGTEALRAGLPPQAVAAARAGLAL
LLQDAGAANPALPGWQGAARGFGAMDGASLAEALRRGGPELDPVRDLVADCLARTEARRQALDRSRPAGW
GAMLAVLAGAWLLAALGWAFWVETGQSRALDRLFQAEAVAAGLDRDAPFADLGARLDRLQRAEAQVAAGM
ARVRVRPLGWLTGRDAARRAAAALAEARARHLPPALARAIDGALAGEGEPAAAYDTLRAWSVLSGAAEWQ
PAWLAGWAEDRVGADPALAGLAPHMLALPRRPDTPVVPPDAELLAQARILAAEAPEPERAFLELRRLAEA
AALPPWRPLQALPVLADIAERRSGQPLGRPIPGLYTVAGWDMARARGAGLAVEAARQAGATLFAQAPAQQ
NDSPDRVMALLQGATLQHWQDWLADLRLRSFDDRRRAVLVSGALSRPDSPLAALIAEVWRQVGGTDRSRP
HELQLAVAVRFGPEIQYVESGRIAQIAALFAELNVALGAMDADAADAQRRLLGVQARARTVRALRDAPPL
IGRLVEDTLAESGAAEASDLTNPLTRAWQAEVLPLCAPALAGRFPFAQGPDADPAAVAALIGPGGAMDRF
LGARAATLLDRDADPWRWKPEARFAGLSPDSAAFLQRALTAGAALAPGLRISAAALAERGRATLLVGGHG
GPVGAAGDAVALDWPGADPAAGVEVSFATPEGAARLQQPGPWGLMRLLAPLRLRERDGGRRFLIDLRTEG
ARLFLEMEFERPLNPLSARRLLAGLACPQVL
 
Nucleotide Sequence: 2406 bp     [Download]
>gi|119382757|ref|NC_008686.1|:c2468447-2466042 Paracoccus denitrificans PD1222 chromosome 1, complete sequence
ATGGCAGGCCGAAGGGAAGCTCTGACCGCCGTCGCCGGGCGGCTGGCCCAGCCGGTGCTGGCCTATGCCG
AGCGCCTGCCCTGGGTGGCCGAGGACATGGCGGCGCTGGCCGGCCATGCGCGGGTGCTGCTGGACCGCTT
CGGCACCGAGGCGCTGCGCGCGGGCCTGCCGCCTCAGGCGGTGGCGGCGGCGCGGGCCGGGTTGGCGCTG
CTTTTGCAGGATGCGGGCGCGGCCAATCCGGCGCTGCCGGGCTGGCAGGGCGCTGCGCGCGGCTTTGGCG
CCATGGACGGCGCCAGCCTGGCCGAGGCCCTGCGGCGCGGCGGGCCCGAGCTTGACCCGGTGCGCGACCT
GGTTGCCGATTGCCTGGCCCGGACCGAGGCGCGGCGCCAGGCGCTGGACCGCAGCCGGCCGGCGGGCTGG
GGCGCCATGCTGGCCGTGTTGGCCGGGGCATGGCTGCTTGCCGCGCTGGGCTGGGCGTTCTGGGTCGAAA
CCGGGCAAAGCCGGGCGCTCGACCGCCTGTTTCAGGCCGAAGCGGTGGCGGCGGGACTGGATCGCGATGC
GCCTTTCGCCGATCTGGGCGCGCGGCTTGATCGGTTGCAGCGGGCCGAGGCTCAGGTGGCGGCGGGCATG
GCGCGGGTCCGGGTGCGGCCACTGGGCTGGCTGACCGGGCGCGACGCCGCCCGTCGCGCGGCGGCGGCGC
TGGCCGAGGCGCGCGCCCGCCACCTGCCGCCGGCGCTGGCCCGCGCCATCGACGGCGCCCTGGCCGGCGA
GGGCGAGCCCGCAGCCGCCTATGACACGCTGCGCGCCTGGTCGGTGCTGTCGGGTGCGGCGGAATGGCAA
CCCGCCTGGCTGGCCGGCTGGGCCGAGGATCGCGTCGGCGCCGATCCTGCGCTGGCCGGCCTTGCGCCGC
ATATGCTGGCCCTGCCGCGCCGTCCCGACACCCCGGTCGTGCCGCCCGATGCCGAATTGCTGGCGCAAGC
GCGCATCCTGGCGGCCGAGGCGCCCGAACCCGAGCGCGCCTTTCTGGAACTGCGCCGCTTGGCCGAGGCG
GCGGCGCTGCCGCCCTGGCGCCCCTTGCAGGCGCTGCCGGTGCTGGCGGATATCGCCGAGCGCCGCTCGG
GTCAGCCGCTGGGCCGGCCGATTCCGGGGCTTTACACCGTCGCCGGCTGGGACATGGCCCGGGCGCGCGG
CGCGGGGCTGGCGGTCGAGGCGGCAAGGCAGGCCGGCGCGACGCTGTTCGCCCAGGCGCCGGCCCAGCAG
AACGACAGTCCCGACCGGGTGATGGCGCTGCTGCAGGGCGCGACCTTGCAGCACTGGCAGGACTGGCTTG
CGGACCTGCGGCTGCGTTCCTTTGACGACCGGCGGCGGGCGGTGCTGGTCTCGGGGGCGCTGTCGCGGCC
GGATTCTCCCCTGGCGGCGCTGATCGCCGAGGTCTGGCGTCAGGTGGGCGGCACCGACCGCAGCCGCCCG
CATGAGCTGCAATTGGCCGTCGCCGTCCGCTTCGGCCCCGAGATCCAATATGTCGAAAGCGGCCGCATCG
CCCAGATCGCCGCGCTGTTCGCCGAGTTGAACGTGGCGCTGGGGGCCATGGACGCGGATGCGGCGGATGC
GCAGCGCCGGCTGCTTGGCGTGCAGGCCCGGGCGCGCACGGTCAGGGCGCTGCGCGACGCGCCGCCGTTG
ATCGGCCGGCTGGTCGAGGACACGCTGGCCGAAAGCGGCGCGGCCGAGGCCAGCGACCTGACCAACCCGC
TGACCCGCGCCTGGCAGGCCGAGGTGTTGCCGCTTTGCGCCCCCGCGCTGGCCGGGCGTTTCCCCTTTGC
CCAAGGCCCCGATGCCGATCCGGCCGCGGTCGCCGCCCTGATCGGGCCGGGCGGCGCGATGGACCGTTTC
CTGGGCGCACGCGCCGCCACCCTGCTGGACCGCGATGCCGATCCCTGGCGCTGGAAGCCCGAGGCGCGCT
TTGCCGGGCTCAGCCCCGACAGCGCCGCCTTTCTGCAACGCGCGCTGACGGCGGGGGCGGCGCTGGCGCC
GGGGCTGCGCATCTCGGCCGCCGCTCTGGCCGAACGCGGCCGGGCCACGCTGCTGGTCGGCGGCCATGGC
GGGCCGGTGGGCGCGGCGGGGGATGCGGTGGCGCTGGACTGGCCGGGCGCCGATCCCGCCGCCGGGGTCG
AGGTCAGCTTTGCGACGCCCGAGGGCGCGGCCCGGTTGCAGCAGCCCGGCCCCTGGGGCCTGATGCGCCT
GCTGGCGCCCCTGCGGCTGCGCGAACGCGACGGCGGCCGGCGCTTCCTGATCGACCTGCGCACCGAAGGC
GCGCGGCTGTTTCTGGAGATGGAGTTCGAGCGGCCGTTGAACCCGCTGTCGGCCCGGCGCCTGCTGGCGG
GGCTGGCCTGTCCGCAGGTGCTGTAA
 Primer design