SecReT6
Protein ID: 119897593
SecReT6 ID160
T6SS typei4b
Gene symbol-
Locus tagazo1302
StrainAzoarcus sp. BH72
Repliconchromosome [GenBank: NC_008702] [Browse all T6SS(s) in this replicon]
Location [Strand]1417056..1420748 [+]
Producthypothetical protein
NoteTssM
UniProt IDA1K514
KEGG IDazo:azo1302
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 4.00E-44, Aligned region: 476..848
ImcF-related_N [PF14331], Evalue: 4.60E-37, Aligned region: 180..435
DUF1215 [PF06744], Evalue: 1.10E-22, Aligned region: 404..428
DUF1215 [PF06744], Evalue: 1.10E-22, Aligned region: 519..554
DUF1215 [PF06744], Evalue: 1.10E-22, Aligned region: 973..1090
Protein Sequence: 1230 a.a.     [Download]
>gi|119897593|ref|YP_932806.1| hypothetical protein azo1302 [Azoarcus sp. BH72]
MNPRFRRLMRISGPALLLLAAVLVLVQTLPPGWDRGGEGVVRVLAAFSVVLLAGVALWAFSRRWRMRGAT
GAAAQARPGPASAEPGSVLRSGLRAAVESIRASDLGRRAGRNALGQLPWYGVIGAEGAGKTALIKQSGLS
FPFEHLPGCPDDGDCGWFLATEAVVLDLGGRYLSDSLGDSSWLEFWRELKRLRPAQPLDGLVAAVSAAEL
LGGDERALHAHATRVRACIDEIQDAVGVRLPVYLVVTQLDLIGQGALPSERDAPRSPFGFAIPAVPADRT
IDSVAERFALFRAGLRHHVLAAAEMHDPLTQSEQLSFSVEFDGLGARLNSFVRVLLGNNPYHVQPALRGV
YFSSLPAGGGHTVLGPRTDALAQRFELDLRDTRSSGFSHDRQDAPSPARLFHDVVLPDRFFARRLRSASA
SQGRWAWMATSLAVVCLAVGLMTASFTGNHQLLTELAASQQAAQTSGDGVPLAVELERLVALQHQLERLR
RYRLAQPPWRLRFGLYQGDKVEAMLRARYFAGVRQLMLEPVAREIERELGATASAPVRRAGAGRPAGAVT
ANDRPPAGLPIIPLGEGAAAQPLRAAGIPPGGPALSARVRRSAGESAGIEGQYNALKTYLMLADPSRIEA
EHLADQLPRFWRRWLQAERGQTPLPDIYALAQRMVDFYIEERAAPDLPVIAAEGALVARSRSALIGAMRR
LPPEERIYRALLAAANVRFEPVSVTGVLRDHASDLVGGSVVVPGAFTRKAYDEYLRSAFGLSGRDLDTGT
DWVLDDHAGNLAESSSGAVDPGALERRYREDFEIAWLGFLQGLTVPVFADLAAATDALGQLGDPARSPLL
PLLQRAGHELGGRGRAVEGERGRMETVLARARGVLDAGRSEAVADAGPASEASPLPGVVALAGGPVEAGD
PRLDGALREYLARLLKLRDRLAVVAAAGSDAEPAIRLVRATFDGRESEFPASLSFVDNELLGAMDSASRT
ALRPVLTQPVLRAFDALIPLVSRDLDLAWQREVLPHWRRLAETFPFSDSEHDVVPSELAEFAAQGGVLDR
FVERRLEGLVSRRGQGLATRNWGDRSIALNPAFLPALERLLAFGAALPRQGELARFELQPMPTPGLTEIV
IEIDGQSLRYRNGPQTWASFSWPGTAVQEAAVRVVDVSGAPGAVLHRRGRMALIRLLAEASVQGATPGPL
QFAWNGAGAAVRFNFRSLSGASPLDLLALRKLTLPDRISR
 
Nucleotide Sequence: 3693 bp     [Download]
>gi|119896292|ref|NC_008702.1|:1417056-1420748 Azoarcus sp. BH72 chromosome, complete genome
ATGAATCCTCGCTTCAGGCGTTTGATGCGGATTTCCGGGCCGGCGCTGTTGCTCCTGGCGGCGGTGCTGG
TGCTTGTCCAGACCTTGCCGCCCGGATGGGACCGCGGGGGTGAGGGCGTCGTGCGGGTGCTTGCGGCATT
TTCGGTGGTGTTGCTGGCAGGCGTTGCTCTGTGGGCCTTCTCGCGACGCTGGCGCATGCGCGGAGCAACA
GGCGCGGCAGCGCAAGCGCGGCCGGGACCCGCAAGCGCCGAGCCGGGGTCTGTCCTACGCAGTGGTCTCA
GGGCCGCTGTCGAATCGATTCGTGCCTCCGACCTGGGGCGCCGGGCGGGCCGCAATGCGCTCGGCCAGTT
GCCCTGGTACGGCGTGATCGGGGCCGAGGGCGCGGGCAAGACCGCTTTGATCAAGCAGTCGGGCTTGAGC
TTTCCTTTCGAGCACCTTCCCGGCTGCCCTGACGATGGCGATTGCGGCTGGTTTCTGGCGACGGAGGCGG
TGGTGCTCGACCTTGGCGGGCGCTACCTGTCGGACTCGCTTGGCGATTCGTCGTGGTTGGAGTTCTGGCG
TGAGTTGAAGCGGTTGCGTCCTGCCCAGCCGTTGGACGGCCTCGTCGCCGCTGTCAGCGCAGCGGAGCTG
CTGGGCGGCGACGAGCGGGCGCTCCACGCGCATGCCACCCGAGTGCGGGCCTGCATCGATGAAATCCAGG
ATGCGGTAGGGGTGCGCCTGCCGGTGTATCTCGTCGTCACCCAGCTCGACCTGATCGGACAGGGCGCTTT
GCCATCCGAACGTGATGCGCCACGCAGCCCGTTCGGGTTCGCAATCCCCGCCGTTCCTGCGGACCGGACC
ATCGATTCGGTGGCCGAGAGGTTCGCGCTGTTTCGCGCCGGCCTGCGCCATCACGTCCTGGCTGCGGCCG
AGATGCACGATCCACTGACGCAGTCCGAGCAGCTCAGCTTTTCGGTGGAGTTCGACGGGCTCGGAGCACG
CTTGAACAGCTTCGTTCGCGTTCTGCTCGGCAATAACCCCTACCACGTACAGCCCGCCCTGCGCGGTGTC
TATTTCAGTTCGCTGCCCGCGGGTGGCGGACATACGGTTCTTGGGCCGAGAACGGATGCGCTGGCGCAGC
GGTTCGAACTCGACCTGCGCGATACGCGTTCTTCGGGCTTCAGCCACGACAGGCAAGACGCCCCCTCTCC
GGCCAGGCTCTTCCACGACGTCGTGCTTCCGGACCGGTTTTTCGCCCGCCGGCTGAGGAGCGCCAGCGCG
AGCCAAGGCCGGTGGGCGTGGATGGCGACCAGCCTCGCCGTGGTCTGCCTTGCCGTCGGTCTGATGACCG
CGTCGTTTACCGGTAATCACCAGCTACTAACCGAACTCGCAGCGTCCCAGCAGGCTGCGCAGACTTCCGG
CGACGGCGTTCCGCTTGCCGTCGAGCTGGAACGACTCGTGGCCCTTCAGCACCAACTCGAGCGCCTTCGG
CGGTACCGGTTGGCGCAACCGCCGTGGCGGCTTCGGTTCGGCCTTTATCAGGGCGACAAGGTGGAGGCAA
TGCTGCGCGCGCGCTACTTTGCCGGTGTGCGGCAACTGATGCTGGAACCGGTCGCGCGCGAGATCGAGCG
CGAGCTGGGCGCGACGGCAAGTGCTCCCGTGAGGCGTGCGGGTGCGGGACGCCCTGCCGGGGCGGTCACG
GCCAACGACCGTCCCCCGGCGGGGCTGCCGATCATTCCCCTCGGCGAGGGGGCGGCGGCGCAGCCGCTGC
GGGCGGCGGGAATTCCCCCTGGCGGCCCGGCGTTGTCGGCGCGAGTCCGCCGCTCCGCGGGTGAGTCTGC
CGGCATCGAGGGGCAATACAACGCGCTCAAGACCTATCTGATGCTCGCCGATCCCTCCCGTATCGAGGCT
GAGCATCTGGCTGATCAGTTGCCGCGCTTCTGGCGCCGCTGGCTTCAGGCCGAACGGGGCCAGACGCCTT
TGCCGGATATCTACGCGCTCGCGCAGCGCATGGTGGACTTCTACATCGAAGAGCGGGCGGCGCCTGACCT
CCCCGTGATCGCTGCTGAAGGCGCGCTCGTTGCGCGATCACGCTCCGCCCTGATAGGCGCAATGCGGCGC
CTGCCGCCCGAGGAGCGGATCTATCGCGCGCTGCTTGCTGCCGCGAATGTGAGATTCGAGCCGGTGTCCG
TCACCGGGGTCCTTCGCGATCACGCTAGCGACCTGGTCGGTGGCAGCGTTGTCGTGCCCGGCGCGTTCAC
CCGCAAGGCATACGACGAATACCTGCGCTCGGCATTTGGCCTTTCCGGGCGGGACCTCGACACCGGCACC
GACTGGGTTCTCGACGACCACGCCGGAAATCTAGCGGAATCCAGCAGCGGCGCCGTCGACCCCGGGGCGC
TGGAGCGCCGCTACCGCGAGGACTTCGAGATTGCGTGGCTCGGGTTCCTGCAGGGACTGACGGTGCCCGT
CTTCGCGGACCTTGCGGCCGCAACGGACGCGCTCGGACAGCTCGGCGACCCCGCGAGGTCGCCGTTGCTG
CCGCTGCTGCAGCGGGCGGGTCACGAACTGGGCGGGCGGGGACGCGCGGTGGAGGGGGAGAGGGGGCGCA
TGGAAACCGTGCTGGCGCGCGCCCGCGGCGTGCTGGACGCCGGGCGGAGTGAGGCGGTAGCCGACGCAGG
TCCGGCATCGGAAGCCAGCCCGCTGCCAGGCGTCGTGGCACTGGCGGGCGGACCGGTGGAAGCAGGCGAC
CCGCGCCTCGACGGGGCGCTAAGGGAATACCTCGCCCGGCTGTTGAAGCTGCGAGACCGTCTGGCCGTCG
TCGCTGCCGCGGGGAGCGACGCCGAGCCTGCCATACGGCTCGTCCGCGCAACCTTCGACGGCCGGGAGTC
CGAGTTTCCGGCCAGCCTCTCGTTCGTCGACAACGAGTTGCTGGGGGCGATGGATTCCGCCTCCCGAACG
GCTTTGCGACCGGTCCTGACGCAGCCCGTGCTGAGAGCGTTCGATGCGCTGATCCCGCTCGTGAGCCGCG
ATCTCGATCTTGCCTGGCAACGCGAAGTGTTGCCGCACTGGCGCCGGCTGGCCGAGACTTTTCCCTTCTC
CGACAGCGAGCACGATGTGGTGCCGTCCGAACTTGCGGAGTTCGCGGCACAGGGGGGTGTGCTCGACAGG
TTTGTCGAGCGCCGCCTCGAAGGACTTGTAAGCCGACGCGGCCAGGGGCTGGCAACGCGGAACTGGGGAG
ATCGCAGCATCGCCCTCAATCCGGCCTTCCTCCCCGCACTGGAGCGATTGCTCGCGTTCGGTGCGGCGCT
CCCGCGTCAGGGGGAACTGGCCCGCTTCGAACTGCAGCCGATGCCGACGCCCGGGCTCACCGAAATCGTG
ATCGAAATCGATGGCCAGAGTCTGCGCTACCGCAACGGGCCCCAGACCTGGGCGAGTTTCAGTTGGCCGG
GCACTGCGGTGCAGGAGGCCGCGGTGCGCGTCGTCGACGTGTCCGGGGCGCCAGGCGCGGTTCTTCACCG
TCGCGGGCGCATGGCGCTGATCCGGCTGCTGGCCGAGGCCTCCGTCCAGGGCGCCACGCCGGGCCCGCTG
CAGTTTGCGTGGAATGGCGCGGGCGCTGCGGTGCGCTTCAATTTCCGCAGCCTTTCCGGGGCTTCACCGC
TCGATCTGCTGGCCTTGCGCAAGCTGACACTGCCCGACCGGATCAGCCGTTGA
 Primer design