SecReT6
Protein ID: 119900179
SecReT6 ID161
T6SS typei3
Gene symbolimcF
Locus tagazo3890
StrainAzoarcus sp. BH72
Repliconchromosome [GenBank: NC_008702] [Browse all T6SS(s) in this replicon]
Location [Strand]4264709..4268281 [-]
ProductImcF-like protein
NoteTssM
UniProt IDA1KCF0
KEGG IDazo:azo3890
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 1.10E-96, Aligned region: 247..267
IcmF-related [PF06761], Evalue: 1.10E-96, Aligned region: 516..825
IcmF-related [PF06761], Evalue: 1.10E-96, Aligned region: 831..852
ImcF-related_N [PF14331], Evalue: 2.20E-92, Aligned region: 206..465
ImcF-related_N [PF14331], Evalue: 2.20E-92, Aligned region: 1045..1060
DUF1215 [PF06744], Evalue: 1.30E-33, Aligned region: 930..1052
AAA_10 [PF12846], Evalue: 0.001, Aligned region: 144..199
AAA_10 [PF12846], Evalue: 0.001, Aligned region: 245..328
AAA_10 [PF12846], Evalue: 0.001, Aligned region: 421..447
AAA_10 [PF12846], Evalue: 0.001, Aligned region: 812..930
AAA_33 [PF13671], Evalue: 0.0018, Aligned region: 144..156
AAA_33 [PF13671], Evalue: 0.0018, Aligned region: 257..285
AAA_33 [PF13671], Evalue: 0.0018, Aligned region: 422..436
Protein Sequence: 1190 a.a.     [Download]
>gi|119900179|ref|YP_935392.1| ImcF-like protein [Azoarcus sp. BH72]
MKAVFKFLFHPVLLGILGLIALALVIWFVGPLIAVAGWAPLESALARLILIGLVVAFVVFRLVWRKIKAK
KQNAQLVEGLVKADDAGADKAATPDEVETLRKRFEEALRVLKDSQAAAHARQGGVARLLSAGSGRYLYEL
PWYVFIGAPGSGKTTALINSGLHFPLAEKLGIHQLKGVGGTRNCDWWFTDDAVLIDTAGRYTTQDSDQAS
DRGAWQGFLGLLKRHRPRQPLNGVLLTVSLGDLLAQDADGAERHAAALRARVQELYEQLNVRLPIYVLVT
KADLIAGFNEFFNDFGKEARDQVWGVTFPQQGDSAAALQALPGELGRLRERVLDLLPVRLRDERDLARRG
AIAAFDQQLAAANRLLGAFLGKVFAPSGFDHALMLRGVYFTSGTQEGSPIDRVMSSLGSAFGLERRVIPP
QSGSGKSFFITRLLREVVFAEQRIGGTNLKWERRRGLVRLATFAGIGVLTVGLALAWALSYHNNDAYIDA
VGERVKTVQPVVADARVAASDDVVGILPVLDAVRTVSHTDLRPQGEAPLSMRFGLYQGDKLDAAAEQAYR
GMLRDVLLPRIAMRVEKQLRNLDPNNLEFAYEALKSYIMLHDATHFDAESIKAWISLDWELNLPRDTTAE
QRAALAGYLDALFKDGAVVSPVAADAELIARVRNQLLRYTLPDRIYSRLKRQGVGSEFPEFTVEKAVGPS
ASLVFVRKSGQPLTRGVPGLYSFDGYHKGFDPQVERVSAHLAEEEPWVLGTASAKPDAAGAKQVADEVRR
LYLTDYARVWEAYIDDIAVQRAGSLQQSIQVARVLSAADSPLPKLMKAMSRETTLIVATEDKSVIDKAQQ
RVAEARSELGRMIFGANQPGQGAAAGAGIERIVDDRFVALRQLVTGDGNTAPINAVVTLLNDVYVNLSAT
ETALRDKVAPPPSDATARVKAESARMPEPVRSMLQQLSAAGTGQALSSLRESLSTAVATQVGQFCGQATD
GRYPFVRSSARDVTRDDFAALFGPGGKFDSFFNQQLAQYVDVGTSPWSFRKVQEQSLGAPGNLVQFQRAS
VIRDVFFRSGGNLRLDFKPIEMDPAITHFTLDVDGQLVNYAHGPQVPQSVQWPGPKGGLQVRVQITPPGQ
SGTSGIATDGPWALFRMLDKANITPTSLPEKFRATFVVDGRSAVFEVTTNSVQNPFRLRELVDFRCPSGL
 
Nucleotide Sequence: 3573 bp     [Download]
>gi|119896292|ref|NC_008702.1|:c4268281-4264709 Azoarcus sp. BH72 chromosome, complete genome
ATGAAAGCCGTCTTCAAGTTCCTCTTCCACCCGGTGCTGCTCGGCATCCTCGGGCTGATCGCGCTGGCGC
TGGTGATCTGGTTCGTCGGTCCGCTGATCGCGGTCGCCGGCTGGGCGCCGCTGGAGTCCGCGCTGGCGCG
GCTGATCCTGATCGGGCTGGTGGTCGCCTTCGTGGTGTTCCGCCTCGTGTGGCGCAAGATCAAGGCGAAG
AAGCAGAACGCCCAGCTCGTCGAAGGTCTGGTCAAGGCCGACGACGCCGGCGCCGACAAGGCCGCCACGC
CCGATGAGGTCGAAACCCTGCGCAAGCGCTTCGAGGAAGCGCTGCGGGTGTTGAAGGACAGCCAGGCCGC
GGCGCACGCCAGGCAGGGCGGCGTTGCCCGCCTGCTGTCGGCCGGGTCCGGCCGCTATTTGTACGAGCTG
CCGTGGTACGTCTTCATCGGCGCGCCGGGCTCGGGCAAGACCACCGCGCTGATCAACTCCGGCCTGCACT
TCCCGCTCGCCGAGAAACTCGGCATCCACCAGTTGAAGGGTGTCGGCGGCACGCGCAACTGCGACTGGTG
GTTCACCGACGACGCGGTGCTGATCGACACCGCCGGCCGCTACACCACCCAGGATTCCGACCAGGCCAGC
GACCGCGGCGCCTGGCAGGGCTTCCTCGGCCTGCTGAAGCGCCATCGCCCGCGCCAGCCGCTCAACGGTG
TGCTGCTCACCGTCAGCCTCGGCGACCTGCTGGCGCAGGATGCCGACGGCGCCGAACGCCATGCCGCCGC
GCTGCGCGCCCGCGTGCAGGAGCTGTACGAGCAGCTCAACGTCCGCCTGCCGATCTACGTGCTGGTCACC
AAGGCCGACCTGATCGCCGGCTTCAACGAATTCTTCAACGATTTCGGCAAGGAAGCGCGCGACCAGGTGT
GGGGCGTCACCTTCCCGCAGCAGGGCGATTCCGCCGCCGCGCTGCAGGCGCTGCCGGGCGAACTCGGGCG
CCTGCGCGAGCGTGTGCTCGACCTGCTGCCGGTGCGCCTGCGCGACGAGCGCGACCTTGCGCGGCGCGGC
GCGATCGCCGCCTTCGACCAGCAGCTCGCGGCCGCCAACCGCCTGCTCGGCGCCTTCCTCGGCAAGGTGT
TCGCCCCGTCCGGTTTCGACCACGCGCTGATGCTACGCGGGGTGTATTTCACCAGCGGCACGCAGGAAGG
CAGCCCGATCGACCGCGTGATGTCCTCGCTCGGTTCCGCCTTCGGCCTCGAACGCCGCGTGATTCCGCCG
CAAAGCGGCAGCGGCAAGAGCTTCTTCATCACCCGCCTGCTGCGCGAAGTGGTGTTTGCCGAGCAGCGCA
TCGGCGGCACCAACCTGAAGTGGGAACGCCGCCGCGGTCTGGTGAGGCTGGCGACGTTTGCCGGCATCGG
CGTGCTCACCGTCGGGCTCGCGCTCGCCTGGGCCTTGAGCTATCACAACAACGACGCCTACATCGACGCC
GTCGGCGAGCGCGTGAAGACGGTGCAGCCGGTCGTCGCCGACGCCCGCGTGGCCGCCTCCGACGATGTGG
TCGGCATCCTGCCGGTGCTCGACGCGGTGCGCACCGTGTCGCACACCGACCTGCGGCCGCAGGGCGAGGC
GCCGCTGTCGATGCGCTTCGGCCTGTACCAGGGTGACAAGCTCGACGCTGCCGCCGAGCAGGCCTATCGC
GGCATGCTGCGCGACGTGCTGTTGCCGCGGATCGCGATGCGGGTCGAAAAGCAGCTGCGCAACCTCGACC
CCAACAATCTCGAGTTCGCCTACGAGGCGCTGAAGAGCTACATCATGCTGCACGATGCGACGCACTTCGA
TGCCGAGTCGATCAAGGCCTGGATCAGCCTCGACTGGGAACTCAACCTGCCGCGCGACACCACCGCCGAG
CAGCGTGCGGCGCTCGCCGGCTACCTCGACGCCTTGTTCAAGGACGGCGCGGTGGTGTCGCCGGTGGCGG
CGGATGCGGAGCTGATCGCGCGGGTGCGCAACCAGCTGCTGCGCTACACCCTGCCGGACCGCATCTACAG
CCGCCTCAAGCGCCAGGGCGTGGGCAGCGAATTCCCCGAATTCACCGTCGAAAAGGCGGTCGGCCCGTCG
GCCTCGCTGGTGTTCGTGCGCAAGAGCGGCCAGCCGCTGACCCGCGGCGTGCCCGGCCTGTACAGCTTCG
ACGGCTACCACAAGGGCTTCGACCCGCAGGTCGAGCGCGTCTCCGCCCACCTCGCCGAGGAAGAACCTTG
GGTGCTCGGCACCGCCTCGGCCAAGCCGGACGCCGCCGGCGCCAAGCAGGTGGCGGACGAAGTGCGCCGG
CTCTACCTGACCGACTACGCCCGCGTGTGGGAAGCCTACATCGACGACATCGCGGTGCAGCGCGCCGGCA
GCCTGCAGCAGAGCATCCAGGTGGCGCGGGTGCTGTCGGCGGCGGATTCGCCGCTGCCCAAGCTGATGAA
AGCGATGTCGCGCGAGACCACGCTGATCGTCGCTACCGAGGACAAGTCGGTGATCGACAAGGCCCAGCAG
CGCGTGGCGGAAGCCCGCAGCGAACTCGGCCGCATGATCTTCGGCGCCAATCAGCCCGGCCAGGGCGCAG
CCGCCGGTGCCGGCATCGAGCGCATCGTGGACGACCGCTTCGTGGCGCTGCGCCAGCTCGTCACCGGCGA
CGGCAACACCGCGCCGATCAATGCGGTGGTGACGCTGCTCAACGATGTGTACGTCAATCTGTCGGCCACC
GAAACCGCGCTGCGCGACAAGGTGGCGCCGCCGCCGTCGGATGCCACCGCGCGCGTCAAGGCGGAAAGCG
CGCGCATGCCCGAGCCGGTGCGCTCGATGCTGCAGCAGCTCTCCGCCGCCGGCACCGGTCAGGCGCTGAG
TTCGCTGCGCGAATCGCTGTCCACCGCGGTGGCCACCCAGGTCGGCCAGTTCTGCGGTCAGGCCACCGAC
GGCCGCTATCCCTTCGTGCGCAGCAGCGCGCGCGATGTCACCCGCGACGATTTCGCCGCGCTGTTCGGCC
CCGGCGGCAAGTTCGACAGCTTCTTCAACCAGCAGCTGGCGCAGTATGTGGATGTCGGCACCTCGCCGTG
GAGCTTCCGCAAGGTGCAGGAACAGTCGCTTGGCGCCCCTGGCAATCTGGTGCAGTTCCAGCGCGCCTCG
GTGATCCGCGACGTGTTCTTCCGCAGCGGCGGCAACCTGCGGCTGGACTTCAAGCCCATCGAGATGGACC
CCGCGATCACCCACTTCACGCTCGATGTAGACGGTCAGCTGGTGAACTACGCGCATGGTCCGCAGGTGCC
GCAGTCGGTGCAGTGGCCCGGCCCCAAGGGCGGCCTGCAGGTGCGGGTGCAGATCACGCCGCCGGGCCAG
AGCGGCACCTCCGGCATCGCCACCGACGGCCCCTGGGCGCTGTTCCGCATGCTCGACAAGGCCAACATCA
CGCCGACTTCGCTGCCGGAGAAGTTCCGCGCCACCTTCGTGGTGGATGGCCGCTCGGCGGTGTTCGAAGT
GACCACCAACAGCGTGCAGAACCCCTTCCGCCTGCGCGAGCTGGTGGATTTCCGCTGCCCGTCCGGGCTG
TGA
 Primer design