SecReT6
Protein ID: 119943799
SecReT6 ID162
T6SS typei1
Gene symbolftsN
Locus tagPing_0005
StrainPsychromonas ingrahamii 37
Repliconchromosome [GenBank: NC_008709] [Browse all T6SS(s) in this replicon]
Location [Strand]10064..10597 [-]
Productcell division protein FtsN
NoteSPOR
UniProt IDA1SQW5
KEGG IDpin:Ping_0005
PDB IDNA
Domain hit(s) vs Pfam SPOR [PF05036], Evalue: 2.70E-15, Aligned region: 105..173
Protein Sequence: 177 a.a.     [Download]
>gi|119943799|ref|YP_941479.1| ftsN gene product [Psychromonas ingrahamii 37]
MATENRRKPATPKKAVVRKRTAVKKTASKKGIPYLAISAVVLIIGFIGFFMFGVEKPSAPQRVNKPVQKK
EDVLPEKPQPIWEYEKTLKTKKITVDIPEKEAQTRPYQMQCASFRARGDAESLKAKIAFQGLNSEVLKTG
DWYRVILGPYERKRLAEKHRHKLQRAKINGCQIWFWR
 
Nucleotide Sequence: 534 bp     [Download]
>gi|119943794|ref|NC_008709.1|:c10597-10064 Psychromonas ingrahamii 37 chromosome, complete genome
ATGGCAACCGAAAACAGACGAAAACCGGCTACTCCAAAAAAAGCCGTCGTGCGTAAACGCACGGCGGTAA
AAAAAACAGCATCTAAAAAAGGGATTCCCTACTTAGCTATTTCTGCTGTTGTATTGATCATCGGATTTAT
TGGTTTTTTTATGTTTGGGGTTGAAAAACCGTCCGCGCCACAAAGAGTGAATAAACCTGTTCAGAAAAAA
GAGGACGTTTTACCAGAAAAACCTCAACCTATCTGGGAATATGAAAAAACACTTAAAACCAAGAAAATAA
CCGTTGATATACCTGAAAAGGAAGCACAAACAAGACCTTATCAAATGCAGTGTGCTTCATTTCGTGCACG
AGGTGATGCAGAATCACTCAAAGCTAAAATTGCATTTCAGGGTTTAAATAGCGAAGTATTAAAAACAGGT
GATTGGTACCGGGTTATTTTAGGGCCCTATGAACGTAAAAGACTGGCAGAAAAACACCGTCATAAACTAC
AGCGAGCTAAAATTAATGGTTGCCAAATTTGGTTCTGGCGTTAA
 Primer design