SecReT6
Protein ID: 119943805
SecReT6 ID162
T6SS typei1
Gene symbol-
Locus tagPing_0011
StrainPsychromonas ingrahamii 37
Repliconchromosome [GenBank: NC_008709] [Browse all T6SS(s) in this replicon]
Location [Strand]17602..18108 [+]
Producthypothetical protein
NoteTssB
UniProt IDA1SQX1
KEGG IDpin:Ping_0011
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 9.80E-54, Aligned region: 9..162
Protein Sequence: 168 a.a.     [Download]
>gi|119943805|ref|YP_941485.1| unnamed protein product [Psychromonas ingrahamii 37]
MSMKDKRSGSVAPKERINISYKPAVGNAKEAVELPFKLLVLGDFTQSQIVTSLEDRKLININKYNFSDVM
DSFDLKVQFSVENKINKGSDEPIDISLSIKQLSDFEPDSIIQQVDELKKVLELREALKALKGPIGNSPQM
RKQIRNLLIDEKSRNELKLELGLSANKQ
 
Nucleotide Sequence: 507 bp     [Download]
>gi|119943794|ref|NC_008709.1|:17602-18108 Psychromonas ingrahamii 37 chromosome, complete genome
ATGTCTATGAAAGACAAGCGCTCAGGTTCAGTTGCACCTAAAGAGCGTATTAATATATCTTATAAACCAG
CGGTAGGTAACGCTAAAGAAGCCGTTGAACTCCCTTTTAAACTGCTAGTCTTAGGAGATTTCACCCAAAG
TCAAATAGTTACTTCTCTGGAAGATAGAAAGTTAATTAATATAAATAAATATAATTTCTCCGATGTAATG
GATAGCTTTGACCTTAAAGTTCAATTTAGTGTAGAAAATAAAATCAATAAAGGAAGTGATGAGCCAATTG
ATATATCTCTAAGTATAAAACAGTTAAGTGACTTTGAACCAGATAGTATTATCCAACAAGTTGATGAATT
GAAAAAAGTTCTTGAGCTTCGAGAGGCATTAAAAGCACTGAAAGGCCCAATCGGTAATTCCCCTCAAATG
CGTAAACAAATACGCAACCTTTTAATTGATGAAAAATCACGAAATGAATTAAAACTTGAGCTGGGTTTAT
CTGCTAATAAACAATAA
 Primer design