SecReT6
Protein ID: 119943806
SecReT6 ID162
T6SS typei1
Gene symbol-
Locus tagPing_0012
StrainPsychromonas ingrahamii 37
Repliconchromosome [GenBank: NC_008709] [Browse all T6SS(s) in this replicon]
Location [Strand]18217..19665 [+]
Producthypothetical protein
NoteTssC
UniProt IDA1SQX2
KEGG IDpin:Ping_0012
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.80E-171, Aligned region: 57..479
Protein Sequence: 482 a.a.     [Download]
>gi|119943806|ref|YP_941486.1| unnamed protein product [Psychromonas ingrahamii 37]
MEAIKEESLVGSILGLSKLLSDPYSYDIASQGMQTLLTQVLEEDCDFDNLRVDKRYVESLIDELDEKLSK
QMDEIIHNSVFQALESPWRSLKLLTDRTDFKENIKIEILSVSKNELLEDFEDAADIIETGLYRKVYTDEF
GQYGGDPYGVIIGNYYISPSVPDMNLLSHMSSLSAMTHAPFITSASEEFFGLEDFAELPELKQLEAMFEG
PQYLSWRNFRSSDDARNVGLTLPRFMLRRTYGENIPVSAFNYKESINNKSEYLWGNAAFAYATRLNNSFA
KYRWCPNIIGPQSGGEVADLPIDIVDDSGTDKVFGPVELKVSDRKEFELSELGFIPFTLRKDSDSAVFFS
SNSTQLPKKFTNDDEGKQAEINYRLGTQLPYLFIVNRLAHYIKVLQRENLGSWKSKTELETELNKWIRQY
VADQDNPSAATRSQRPLRKAAISVSDIDTEVGWYSVGMEVTPHFKFMGASFTLSLTSILERA
 
Nucleotide Sequence: 1449 bp     [Download]
>gi|119943794|ref|NC_008709.1|:18217-19665 Psychromonas ingrahamii 37 chromosome, complete genome
ATGGAAGCAATAAAAGAAGAATCATTAGTTGGAAGTATATTAGGTTTAAGCAAGCTTTTAAGTGACCCAT
ATAGTTATGATATTGCAAGTCAAGGGATGCAAACGCTGCTCACTCAGGTACTTGAAGAAGATTGTGATTT
TGATAATCTAAGAGTAGATAAACGTTATGTTGAATCTCTTATTGATGAGCTTGATGAAAAACTCAGTAAG
CAAATGGATGAAATTATCCATAATAGTGTTTTTCAAGCACTAGAATCGCCATGGAGAAGTTTAAAACTGC
TAACGGATAGAACAGATTTCAAAGAAAATATAAAAATTGAAATATTATCAGTATCCAAAAATGAGTTACT
GGAAGATTTTGAAGATGCGGCTGATATAATTGAAACAGGTCTTTATCGTAAAGTTTACACCGATGAATTC
GGACAATATGGTGGTGATCCCTATGGAGTGATTATTGGAAATTATTATATTTCCCCTTCAGTCCCCGATA
TGAATTTACTGAGTCATATGTCCAGTTTAAGTGCTATGACACATGCTCCATTTATAACAAGTGCAAGTGA
AGAATTTTTTGGACTGGAAGATTTTGCAGAATTACCTGAGTTAAAACAATTAGAAGCTATGTTTGAAGGC
CCGCAATATTTATCTTGGCGTAACTTTAGAAGCAGTGATGATGCCAGAAATGTCGGCCTCACTTTACCTC
GATTTATGTTAAGGCGAACATATGGTGAAAATATTCCAGTAAGTGCTTTTAACTATAAAGAAAGTATTAA
CAACAAGTCAGAGTACCTATGGGGCAACGCAGCATTTGCTTATGCAACGCGATTAAATAACAGTTTTGCA
AAATATCGTTGGTGTCCAAATATCATCGGTCCGCAATCAGGTGGTGAAGTCGCTGATTTACCTATTGATA
TCGTTGATGATAGCGGCACTGATAAAGTTTTTGGACCAGTAGAACTTAAAGTGTCAGATAGGAAAGAATT
TGAATTATCTGAACTTGGTTTTATTCCTTTTACACTCCGAAAAGACTCTGACAGTGCAGTCTTTTTCTCA
TCTAATTCAACCCAATTGCCTAAAAAATTCACCAATGATGATGAAGGTAAACAGGCTGAAATTAATTACC
GTTTAGGTACACAACTACCTTACTTATTTATAGTAAACAGGCTGGCTCACTATATTAAGGTATTACAACG
CGAAAATTTGGGTAGTTGGAAGAGTAAAACAGAGCTAGAAACAGAGCTTAATAAATGGATCAGGCAATAT
GTTGCAGATCAAGATAATCCTTCCGCAGCAACAAGAAGTCAACGACCACTCAGAAAAGCTGCAATTTCAG
TCAGTGACATTGATACTGAAGTAGGTTGGTATTCTGTCGGTATGGAAGTGACTCCTCACTTTAAATTTAT
GGGAGCAAGTTTCACACTCTCTCTAACCAGTATTTTAGAACGAGCTTAA
 Primer design

Protein ID: 119943812
SecReT6 ID162
T6SS typei1
Gene symbol-
Locus tagPing_0018
StrainPsychromonas ingrahamii 37
Repliconchromosome [GenBank: NC_008709] [Browse all T6SS(s) in this replicon]
Location [Strand]26407..28101 [+]
Producthypothetical protein
NoteTssC
UniProt IDA1SQX8
KEGG IDpin:Ping_0018
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.10E-122, Aligned region: 151..556
DUF770 [PF05591], Evalue: 1.40E-07, Aligned region: 17..105
DUF770 [PF05591], Evalue: 1.40E-07, Aligned region: 512..531
Protein Sequence: 564 a.a.     [Download]
>gi|119943812|ref|YP_941492.1| unnamed protein product [Psychromonas ingrahamii 37]
MLDVKNISFLPKQGGTVPFKTLILAPLGGHNAIEQLLEPTEINIRNFDTVIKEFSPTVDVDIANSGLCQL
LNVDQQIITLSYTIDCYADFKPTAIIKKEPSLREVSHIIDLIHQQLQLDGTTFSTAPFELQHVKIAELEK
ESVKRHELELVVCELELILSRILNQILHQADWQQLEASWRGIYWLCQTAESSHSLIIECASATKQLLWDD
LFTNTDLLDSNLYQQVYVDSIGQYGAVPYGVLLIDDYFSGAGSDLTLLKAITEVCSKAHLPVVTGANARM
FDVNDFNTLQDSDYISEIHAGHRYIKWRNFISTEEASFLALTMPRLLFRNAYGKGDSALSWFQENIGDSH
EDCLWGNASFGFVDNLLKSFQESGFCTFISGMEGGRLNLSALLNKSPNLPIEIAFSEEKEAELIKLGFNP
VCTRAYHNILLFESANSVRWGNLKLNYRTQNIDTIASAQLQYLFIVMRIIHCLKIIFRESVGATTNSTEL
SHILNRWIRQFVSDVEAPSKSLRAQRPLKDAKVLVVETNNIGWFEIEIELSPHMKYLGSTISINTLIFMN
EEVS
 
Nucleotide Sequence: 1695 bp     [Download]
>gi|119943794|ref|NC_008709.1|:26407-28101 Psychromonas ingrahamii 37 chromosome, complete genome
ATGCTTGATGTCAAAAATATTTCGTTTTTGCCAAAGCAGGGAGGGACGGTTCCTTTTAAAACATTAATCC
TTGCTCCGCTTGGTGGCCATAATGCCATTGAGCAGTTGCTTGAACCAACTGAAATTAATATCCGTAATTT
TGATACTGTTATTAAAGAGTTTTCACCGACTGTTGATGTAGATATAGCTAACTCTGGACTGTGCCAATTA
CTTAATGTCGATCAGCAAATAATCACCCTCAGTTATACTATTGATTGCTACGCAGACTTTAAACCAACAG
CCATTATCAAAAAAGAACCTTCTTTACGGGAAGTTTCACACATTATTGATCTAATACATCAACAACTTCA
GCTAGATGGAACTACTTTTAGTACCGCTCCCTTTGAGCTTCAGCACGTGAAAATCGCCGAGTTGGAAAAA
GAGTCGGTCAAAAGGCATGAACTTGAATTAGTTGTTTGTGAATTAGAGTTAATTCTATCTCGAATATTAA
ACCAAATTCTGCATCAAGCCGATTGGCAGCAGCTTGAAGCATCTTGGCGCGGTATATATTGGCTATGCCA
AACAGCAGAAAGCAGTCACTCTCTGATTATTGAATGTGCCAGTGCAACTAAGCAGTTACTTTGGGATGAT
CTTTTCACTAATACCGACTTACTCGATTCAAATTTATATCAGCAGGTTTACGTTGACAGTATCGGTCAAT
ATGGCGCTGTTCCCTATGGTGTTTTATTAATTGATGATTACTTTTCTGGCGCGGGTTCAGATCTTACTTT
GCTTAAAGCGATTACTGAGGTGTGCAGTAAAGCGCATTTACCTGTTGTCACGGGCGCAAATGCTCGGATG
TTTGATGTTAATGACTTTAATACATTGCAGGATTCAGATTATATTTCTGAAATTCATGCCGGACACCGAT
ATATAAAATGGCGTAATTTTATCTCAACAGAAGAAGCTAGTTTTCTCGCTTTAACCATGCCGAGATTATT
ATTTAGGAATGCCTATGGTAAAGGTGATTCGGCACTCAGTTGGTTTCAAGAAAACATAGGTGATAGTCAC
GAAGACTGCCTATGGGGCAACGCAAGTTTTGGATTTGTTGATAATTTGCTTAAAAGCTTTCAAGAAAGCG
GTTTTTGTACTTTTATTTCCGGCATGGAAGGGGGGCGATTAAATTTATCGGCGTTGTTAAATAAGTCGCC
TAATTTACCCATTGAAATTGCTTTTTCTGAAGAAAAAGAAGCCGAGTTAATAAAGTTAGGCTTTAATCCT
GTCTGTACAAGGGCTTATCACAATATATTACTTTTTGAGTCAGCAAATTCTGTGCGTTGGGGTAATCTAA
AACTTAATTACCGAACACAAAATATTGATACTATTGCCAGTGCCCAATTGCAGTATTTATTTATTGTTAT
GCGTATTATTCATTGTTTAAAAATCATATTCAGAGAAAGTGTTGGTGCGACGACCAACTCAACAGAGTTA
TCTCATATTTTAAATCGATGGATCAGACAATTTGTCTCAGATGTTGAAGCACCTTCTAAATCGTTACGCG
CACAAAGACCCTTAAAAGATGCAAAAGTCCTGGTGGTAGAAACAAATAATATAGGATGGTTTGAGATTGA
AATAGAGCTCAGCCCGCATATGAAATACTTAGGCAGTACTATCTCCATTAATACCCTTATTTTTATGAAT
GAAGAGGTCAGCTAA
 Primer design