SecReT6
Protein ID: 119943807
SecReT6 ID162
T6SS typei1
Gene symbol-
Locus tagPing_0013
StrainPsychromonas ingrahamii 37
Repliconchromosome [GenBank: NC_008709] [Browse all T6SS(s) in this replicon]
Location [Strand]19699..20217 [+]
Productsecreted protein Hcp, potential oxidative stress protein
NoteTssD
UniProt IDA1SQX3
KEGG IDpin:Ping_0013
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 3.20E-28, Aligned region: 6..156
Protein Sequence: 172 a.a.     [Download]
>gi|119943807|ref|YP_941487.1| unnamed protein product [Psychromonas ingrahamii 37]
MPTEIYMSINDPEGCLTEESCSKESIGSFFKADHEEESLILAYDHKVSVPTNSLTGQVTGTRKHEYLEVS
KFIDKSSPLLLNTVTSPSELEVILRFFRTPDETSAGEPVEYYNITLQRAKIVSINTISPNILDEVNDGLM
PYEKVRFTYGQIQADHVVCGTTAIDDWSGEGG
 
Nucleotide Sequence: 519 bp     [Download]
>gi|119943794|ref|NC_008709.1|:19699-20217 Psychromonas ingrahamii 37 chromosome, complete genome
ATGCCTACTGAAATTTATATGTCCATTAATGACCCTGAAGGGTGTTTAACAGAAGAATCTTGTTCAAAAG
AAAGTATAGGTTCATTCTTTAAGGCCGATCATGAAGAAGAGTCATTAATTCTAGCTTACGATCATAAAGT
AAGTGTGCCAACTAATTCATTAACGGGACAGGTGACAGGGACAAGGAAACATGAATATCTGGAGGTCAGT
AAATTTATAGATAAAAGCTCCCCCTTATTGCTTAATACTGTGACCTCCCCATCGGAACTGGAAGTCATTT
TGAGGTTCTTTAGAACCCCGGATGAAACCAGTGCAGGTGAACCTGTAGAGTATTACAACATCACTTTGCA
GCGCGCTAAAATTGTGAGTATTAATACAATATCACCTAATATTTTAGATGAAGTAAATGACGGTTTAATG
CCCTATGAAAAGGTCAGGTTTACTTATGGGCAAATTCAAGCGGATCATGTGGTTTGTGGAACAACTGCGA
TTGATGATTGGTCTGGGGAAGGCGGTTAG
 Primer design