SecReT6
Protein ID: 119943808
SecReT6 ID162
T6SS typei1
Gene symbol-
Locus tagPing_0014
StrainPsychromonas ingrahamii 37
Repliconchromosome [GenBank: NC_008709] [Browse all T6SS(s) in this replicon]
Location [Strand]20228..20935 [+]
Producthypothetical protein
NoteTssJ
UniProt IDA1SQX4
KEGG IDpin:Ping_0014
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 2.20E-16, Aligned region: 19..180
Protein Sequence: 235 a.a.     [Download]
>gi|119943808|ref|YP_941488.1| unnamed protein product [Psychromonas ingrahamii 37]
MKNFIYNSTIWIRITCISILLSGCSLLPNSQVEVQKKDNIDYWSDSSGSWENWDENHPSNELVAWTYDKD
GIQVNFVARPELNIFGQRSHTLVVKIVQLSEVSGINTLFQTNEGIAAALTQETEMIPNAIFSESFVLGPK
QNLMFRLARQENAKYIAIIAGFAELDRRQAVRIIPISVNTTLQEPIDAEWTTLDKMTFGYFVSKEPQPDI
LRPSNIRLNIDFGENSITKFSATAE
 
Nucleotide Sequence: 708 bp     [Download]
>gi|119943794|ref|NC_008709.1|:20228-20935 Psychromonas ingrahamii 37 chromosome, complete genome
ATGAAAAATTTCATTTATAACTCAACAATATGGATACGCATCACTTGCATATCTATATTGCTGAGCGGTT
GTAGTCTATTGCCTAATAGTCAGGTGGAAGTACAGAAAAAAGATAATATTGATTATTGGTCTGATAGCTC
AGGGTCTTGGGAAAACTGGGATGAAAACCACCCCAGTAATGAACTTGTTGCTTGGACATATGATAAAGAT
GGCATTCAAGTCAATTTCGTTGCCCGTCCAGAATTAAATATATTTGGACAACGGTCCCACACTTTAGTCG
TCAAAATTGTTCAGTTATCAGAAGTCTCAGGTATCAATACGCTTTTTCAGACCAACGAAGGGATTGCCGC
TGCGTTAACGCAAGAAACTGAAATGATACCTAATGCCATATTTAGTGAATCATTTGTTTTGGGGCCAAAG
CAAAACCTTATGTTCAGGCTAGCCCGCCAAGAAAATGCCAAGTATATCGCTATTATTGCAGGTTTTGCTG
AGCTAGATAGGCGGCAAGCGGTACGCATTATTCCTATTTCTGTTAATACTACGTTACAAGAGCCGATCGA
TGCCGAGTGGACTACTTTGGACAAGATGACCTTTGGCTATTTTGTAAGTAAAGAGCCTCAACCCGATATT
TTAAGACCCTCAAATATTAGGCTTAATATTGACTTTGGTGAAAACAGTATTACAAAGTTCAGCGCGACAG
CTGAATAA
 Primer design