SecReT6
Protein ID: 119943809
SecReT6 ID162
T6SS typei1
Gene symbol-
Locus tagPing_0015
StrainPsychromonas ingrahamii 37
Repliconchromosome [GenBank: NC_008709] [Browse all T6SS(s) in this replicon]
Location [Strand]20951..22315 [+]
Producthypothetical protein
NoteTssK
UniProt IDA1SQX5
KEGG IDpin:Ping_0015
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 6.80E-82, Aligned region: 19..452
Protein Sequence: 454 a.a.     [Download]
>gi|119943809|ref|YP_941489.1| unnamed protein product [Psychromonas ingrahamii 37]
MDSMKSIYWNQGLFLKPQHFQQLDRYTSTMSNLYSKVRSGVESGISELKFDLSALKTGLLVIEKLECILE
DGSLLLYPGNCQIPPLRLDKEQFDDSGNLNIFIALAPISAEQNNLVSNSSPDARFKLAADINKKDLFDNN
EQATLSMLDFNCNLVPSYNLKSTAGLSLLKVAEIFLSVDQCTPSETFIPKITLLSGSEVLKNLVKSTKQS
LVGRFEQLQNITSFESGLVNSSNNLSVGLAMMSISNHIATFIQFEENPSTQVSDIYLAYRQLISQLSMFS
TEVSVIGETLTEENSIIPFNQNNLSDCFSKVNNLTTKLLNELTVQPELLVNLIYQGDSKFVAQLSREFLD
PGYRIYLRIRTKENVIDHLDNILNFLKVGADGQVDVYLKRALPGVQLSYLDKKPQGVATVPNSYYFGLDR
QSFQWQKVIELSRIGVIWSDYIEDVALDLIAVQG
 
Nucleotide Sequence: 1365 bp     [Download]
>gi|119943794|ref|NC_008709.1|:20951-22315 Psychromonas ingrahamii 37 chromosome, complete genome
ATGGATTCAATGAAGTCGATATATTGGAATCAGGGGCTATTTTTAAAACCTCAGCATTTTCAACAGTTAG
ATAGATATACATCCACTATGTCTAATCTATATTCTAAAGTTCGTAGCGGCGTAGAATCAGGTATTTCAGA
ATTAAAATTTGATCTTTCTGCTTTGAAAACAGGTTTATTAGTCATTGAAAAGTTGGAATGTATATTAGAA
GACGGCAGTTTACTTTTATACCCGGGAAACTGTCAAATTCCACCATTAAGGTTAGACAAAGAGCAGTTTG
ATGACAGTGGGAATCTGAATATATTTATTGCTTTAGCACCCATTTCTGCAGAGCAAAATAATTTAGTTTC
AAATTCATCACCCGATGCTCGCTTTAAGCTTGCCGCTGATATCAATAAAAAAGATCTATTTGATAATAAT
GAACAAGCAACGTTATCGATGTTAGATTTTAATTGTAATTTAGTTCCAAGCTATAATTTGAAAAGTACTG
CGGGTTTATCTCTTCTTAAAGTAGCTGAAATATTTTTATCGGTTGATCAATGCACACCTTCAGAAACTTT
TATTCCTAAGATAACGTTATTAAGCGGTTCTGAAGTACTTAAGAATTTAGTCAAATCAACTAAACAAAGT
TTAGTCGGGCGATTTGAACAACTTCAAAATATAACCTCTTTTGAATCAGGACTTGTAAATAGCTCAAATA
ATTTATCTGTCGGTTTAGCGATGATGTCAATTAGTAATCATATTGCCACATTTATCCAGTTTGAAGAAAA
TCCATCAACACAAGTCTCTGATATTTATCTGGCTTATCGACAATTAATCTCACAATTGAGCATGTTTTCG
ACAGAAGTTTCAGTTATTGGTGAAACCCTTACTGAAGAAAATTCTATTATCCCGTTTAATCAAAATAATT
TAAGCGATTGTTTTTCTAAAGTAAATAATCTGACAACTAAATTATTAAACGAGTTGACCGTTCAGCCTGA
ATTATTAGTTAATTTAATTTATCAGGGTGATTCAAAATTTGTAGCCCAATTATCGCGTGAATTTTTAGAT
CCCGGTTACCGGATTTATCTAAGAATTAGAACCAAAGAAAATGTCATTGATCATTTAGATAATATTCTTA
ATTTTCTAAAAGTTGGGGCCGATGGACAAGTTGATGTTTACTTGAAAAGAGCACTTCCGGGAGTTCAATT
GTCGTATTTAGATAAAAAACCCCAAGGAGTTGCGACTGTCCCGAATAGCTATTATTTTGGTCTTGATAGG
CAGTCCTTCCAATGGCAGAAAGTCATTGAGTTAAGCCGAATTGGTGTTATTTGGAGTGATTATATAGAAG
ACGTTGCTCTCGATTTGATCGCTGTTCAAGGATAA
 Primer design